Detailed information    

experimental Experimentally validated

Overview


Name   sigH   Type   Regulator
Locus tag   SA_RS02890 Genome accession   NC_002745
Coordinates   574310..574879 (+) Length   189 a.a.
NCBI ID   WP_000872882.1    Uniprot ID   -
Organism   Staphylococcus aureus N315     
Function   promote expression of competence genes   
Competence regulation

Function


An over-expression of this sigma factor in S. aureus resulted in a drastic induction of the expression of the com operons that encode proteins required for the natural genetic competence.


Genomic Context


Location: 569310..579879
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SA_RS02865 (SA0487) cysE 570523..571170 (+) 648 WP_001805237.1 serine O-acetyltransferase -
  SA_RS02870 (SA0488) cysS 571154..572554 (+) 1401 WP_000631969.1 cysteine--tRNA ligase -
  SA_RS02875 (SA0489) - 572547..572951 (+) 405 WP_000370182.1 Mini-ribonuclease 3 -
  SA_RS02880 (SA0490) rlmB 572959..573705 (+) 747 WP_000390332.1 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB -
  SA_RS02885 (SA0491) - 573705..574229 (+) 525 WP_000664737.1 NYN domain-containing protein -
  SA_RS02890 (SA0492) sigH 574310..574879 (+) 570 WP_000872882.1 sigma-70 family RNA polymerase sigma factor Regulator
  SA_RS14515 rpmG 574994..575137 (+) 144 WP_001788193.1 50S ribosomal protein L33 -
  SA_RS02895 (SA0493) secE 575193..575375 (+) 183 WP_001074473.1 preprotein translocase subunit SecE -
  SA_RS02900 (SA0494) nusG 575388..575936 (+) 549 WP_001288302.1 transcription termination/antitermination protein NusG -
  SA_RS02905 (SA0495) rplK 576117..576539 (+) 423 WP_001085792.1 50S ribosomal protein L11 -
  SA_RS02910 (SA0496) rplA 576747..577439 (+) 693 WP_001074622.1 50S ribosomal protein L1 -
  SA_RS02915 (SA0497) rplJ 577711..578211 (+) 501 WP_001273085.1 50S ribosomal protein L10 -
  SA_RS02920 (SA0498) rplL 578254..578622 (+) 369 WP_001273586.1 50S ribosomal protein L7/L12 -
  SA_RS02925 (SA0499) - 578797..579405 (+) 609 WP_000020304.1 class I SAM-dependent methyltransferase -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  sigH comGD positive effect
  agrC comGD positive effect
  agrC comGB positive effect
  agrC comGC positive effect
  agrC comGE positive effect
  agrC comGA positive effect
  agrC comGF positive effect
  braS comGD positive effect
  braS comGB positive effect
  braS comGC positive effect
  braS comGE positive effect
  braS comGA positive effect
  braS comGF positive effect
  sigH comGA positive effect
  sigH comGF positive effect
  sigH comGC positive effect
  sigH comGE positive effect
  sigH coiA positive effect
  sigH positive effect
  sigH comEA positive effect
  sigH ssb positive effect
  sigH comGB positive effect
  sigH dprA positive effect
  braR comGD positive effect
  braR comGB positive effect
  braR comGA positive effect
  braR comGF positive effect
  braR comGC positive effect
  braR comGE positive effect
  vraR comGD negative effect
  vraR comGA negative effect
  vraR comGF negative effect
  vraR comGB negative effect
  vraR comGC negative effect
  vraR comGE negative effect
  agrA comGD positive effect
  agrA comGA positive effect
  agrA comGF positive effect
  agrA comGB positive effect
  agrA comGC positive effect
  agrA comGE positive effect
  comK/comK1 comGD positive effect
  comK/comK1 comGE positive effect
  comK/comK1 coiA positive effect
  comK/comK1 positive effect
  comK/comK1 comEA positive effect
  comK/comK1 ssb positive effect
  comK/comK1 comGB positive effect
  comK/comK1 dprA positive effect
  comK/comK1 comGA positive effect
  comK/comK1 comGF positive effect
  comK/comK1 comGC positive effect
  vraS comGD negative effect
  vraS comGC negative effect
  vraS comGE negative effect
  vraS comGA negative effect
  vraS comGF negative effect
  vraS comGB negative effect

Sequence


Protein


Download         Length: 189 a.a.        Molecular weight: 23044.91 Da        Isoelectric Point: 9.4170

>NTDB_id=13 SA_RS02890 WP_000872882.1 574310..574879(+) (sigH) [Staphylococcus aureus N315]
MKYDLTTQDSTIKRNNSINDKDFEKLVMDLQPLIIRRIKTFGFNHYDLEDLYQEILIRMYRSVQTFDFSGEQPFTNYVQC
LITSVKYDYLRKYLATNKRMDNLINEYRVTYPCAIKRFDVENNYLNKLAIKELICQFKYLSAFEKDVMYLMCEQYKPREI
AQLMHVKEKVIYNAIQRCKNKIKRYFKMI

Nucleotide


Download         Length: 570 bp        

>NTDB_id=13 SA_RS02890 WP_000872882.1 574310..574879(+) (sigH) [Staphylococcus aureus N315]
TTGAAATATGATTTGACAACTCAAGACAGTACAATCAAACGTAACAATTCAATAAATGATAAAGACTTCGAAAAGTTAGT
AATGGATCTACAACCATTAATTATTCGACGCATCAAAACATTTGGATTTAATCATTATGATTTAGAAGACTTATATCAAG
AAATACTTATACGGATGTATAGGTCGGTCCAAACATTTGATTTTAGTGGAGAGCAGCCTTTCACAAATTATGTTCAATGT
TTAATTACGTCTGTAAAGTATGATTATTTGAGAAAATATTTAGCTACAAATAAAAGAATGGATAATTTGATTAATGAATA
TAGAGTTACGTATCCATGTGCAATAAAGCGTTTTGATGTTGAAAACAATTATTTGAATAAATTAGCAATTAAAGAGTTGA
TTTGTCAGTTTAAGTATTTGAGTGCATTTGAAAAAGATGTCATGTATTTAATGTGTGAACAATATAAGCCGAGAGAAATT
GCTCAATTGATGCATGTAAAAGAGAAAGTGATTTATAATGCCATACAACGATGTAAAAATAAAATAAAACGTTATTTCAA
AATGATTTGA

Domains


Predicted by InterProScan.

(26-92)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sigH Staphylococcus aureus MW2

97.884

100

0.979


Multiple sequence alignment    



References


[1] Shi Yuan Feng et al. (2023) The complex regulation of competence in Staphylococcus aureus under microaerobic conditions. Communications Biology 6(1):512. [PMID: 37173437]
[2] Annette Fagerlund et al. (2014) Staphylococcus aureus competence genes: mapping of the SigH, ComK1 and ComK2 regulons by transcriptome sequencing. Molecular Microbiology 94(3):557-79. [PMID: 25155269]
[3] Kazuya Morikawa et al. (2012) Expression of a cryptic secondary sigma factor gene unveils natural competence for DNA transformation in Staphylococcus aureus. PLoS Pathogens 8(11):e1003003. [PMID: 23133387]
[4] Kazuya Morikawa et al. (2003) A new staphylococcal sigma factor in the conserved gene cassette: functional significance and implication for the evolutionary processes. Genes To Cells : Devoted To Molecular & Cellular Mechanisms 8(8):699-712. [PMID: 12875655]