Detailed information
Overview
| Name | sigH | Type | Regulator |
| Locus tag | SA_RS02890 | Genome accession | NC_002745 |
| Coordinates | 574310..574879 (+) | Length | 189 a.a. |
| NCBI ID | WP_000872882.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus N315 | ||
| Function | promote expression of competence genes Competence regulation |
||
Genomic Context
Location: 569310..579879
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SA_RS02865 (SA0487) | cysE | 570523..571170 (+) | 648 | WP_001805237.1 | serine O-acetyltransferase | - |
| SA_RS02870 (SA0488) | cysS | 571154..572554 (+) | 1401 | WP_000631969.1 | cysteine--tRNA ligase | - |
| SA_RS02875 (SA0489) | - | 572547..572951 (+) | 405 | WP_000370182.1 | Mini-ribonuclease 3 | - |
| SA_RS02880 (SA0490) | rlmB | 572959..573705 (+) | 747 | WP_000390332.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
| SA_RS02885 (SA0491) | - | 573705..574229 (+) | 525 | WP_000664737.1 | NYN domain-containing protein | - |
| SA_RS02890 (SA0492) | sigH | 574310..574879 (+) | 570 | WP_000872882.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| SA_RS14515 | rpmG | 574994..575137 (+) | 144 | WP_001788193.1 | 50S ribosomal protein L33 | - |
| SA_RS02895 (SA0493) | secE | 575193..575375 (+) | 183 | WP_001074473.1 | preprotein translocase subunit SecE | - |
| SA_RS02900 (SA0494) | nusG | 575388..575936 (+) | 549 | WP_001288302.1 | transcription termination/antitermination protein NusG | - |
| SA_RS02905 (SA0495) | rplK | 576117..576539 (+) | 423 | WP_001085792.1 | 50S ribosomal protein L11 | - |
| SA_RS02910 (SA0496) | rplA | 576747..577439 (+) | 693 | WP_001074622.1 | 50S ribosomal protein L1 | - |
| SA_RS02915 (SA0497) | rplJ | 577711..578211 (+) | 501 | WP_001273085.1 | 50S ribosomal protein L10 | - |
| SA_RS02920 (SA0498) | rplL | 578254..578622 (+) | 369 | WP_001273586.1 | 50S ribosomal protein L7/L12 | - |
| SA_RS02925 (SA0499) | - | 578797..579405 (+) | 609 | WP_000020304.1 | class I SAM-dependent methyltransferase | - |
Regulatory network
Positive effect
Negative effect
| Regulator | Target | Regulation |
|---|---|---|
| sigH | comGD | positive effect |
| agrC | comGD | positive effect |
| agrC | comGB | positive effect |
| agrC | comGC | positive effect |
| agrC | comGE | positive effect |
| agrC | comGA | positive effect |
| agrC | comGF | positive effect |
| braS | comGD | positive effect |
| braS | comGB | positive effect |
| braS | comGC | positive effect |
| braS | comGE | positive effect |
| braS | comGA | positive effect |
| braS | comGF | positive effect |
| sigH | comGA | positive effect |
| sigH | comGF | positive effect |
| sigH | comGC | positive effect |
| sigH | comGE | positive effect |
| sigH | coiA | positive effect |
| sigH | positive effect |
|
| sigH | comEA | positive effect |
| sigH | ssb | positive effect |
| sigH | comGB | positive effect |
| sigH | dprA | positive effect |
| braR | comGD | positive effect |
| braR | comGB | positive effect |
| braR | comGA | positive effect |
| braR | comGF | positive effect |
| braR | comGC | positive effect |
| braR | comGE | positive effect |
| vraR | comGD | negative effect |
| vraR | comGA | negative effect |
| vraR | comGF | negative effect |
| vraR | comGB | negative effect |
| vraR | comGC | negative effect |
| vraR | comGE | negative effect |
| agrA | comGD | positive effect |
| agrA | comGA | positive effect |
| agrA | comGF | positive effect |
| agrA | comGB | positive effect |
| agrA | comGC | positive effect |
| agrA | comGE | positive effect |
| comK/comK1 | comGD | positive effect |
| comK/comK1 | comGE | positive effect |
| comK/comK1 | coiA | positive effect |
| comK/comK1 | positive effect |
|
| comK/comK1 | comEA | positive effect |
| comK/comK1 | ssb | positive effect |
| comK/comK1 | comGB | positive effect |
| comK/comK1 | dprA | positive effect |
| comK/comK1 | comGA | positive effect |
| comK/comK1 | comGF | positive effect |
| comK/comK1 | comGC | positive effect |
| vraS | comGD | negative effect |
| vraS | comGC | negative effect |
| vraS | comGE | negative effect |
| vraS | comGA | negative effect |
| vraS | comGF | negative effect |
| vraS | comGB | negative effect |
Sequence
Protein
Download Length: 189 a.a. Molecular weight: 23044.91 Da Isoelectric Point: 9.4170
>NTDB_id=13 SA_RS02890 WP_000872882.1 574310..574879(+) (sigH) [Staphylococcus aureus N315]
MKYDLTTQDSTIKRNNSINDKDFEKLVMDLQPLIIRRIKTFGFNHYDLEDLYQEILIRMYRSVQTFDFSGEQPFTNYVQC
LITSVKYDYLRKYLATNKRMDNLINEYRVTYPCAIKRFDVENNYLNKLAIKELICQFKYLSAFEKDVMYLMCEQYKPREI
AQLMHVKEKVIYNAIQRCKNKIKRYFKMI
MKYDLTTQDSTIKRNNSINDKDFEKLVMDLQPLIIRRIKTFGFNHYDLEDLYQEILIRMYRSVQTFDFSGEQPFTNYVQC
LITSVKYDYLRKYLATNKRMDNLINEYRVTYPCAIKRFDVENNYLNKLAIKELICQFKYLSAFEKDVMYLMCEQYKPREI
AQLMHVKEKVIYNAIQRCKNKIKRYFKMI
Nucleotide
Download Length: 570 bp
>NTDB_id=13 SA_RS02890 WP_000872882.1 574310..574879(+) (sigH) [Staphylococcus aureus N315]
TTGAAATATGATTTGACAACTCAAGACAGTACAATCAAACGTAACAATTCAATAAATGATAAAGACTTCGAAAAGTTAGT
AATGGATCTACAACCATTAATTATTCGACGCATCAAAACATTTGGATTTAATCATTATGATTTAGAAGACTTATATCAAG
AAATACTTATACGGATGTATAGGTCGGTCCAAACATTTGATTTTAGTGGAGAGCAGCCTTTCACAAATTATGTTCAATGT
TTAATTACGTCTGTAAAGTATGATTATTTGAGAAAATATTTAGCTACAAATAAAAGAATGGATAATTTGATTAATGAATA
TAGAGTTACGTATCCATGTGCAATAAAGCGTTTTGATGTTGAAAACAATTATTTGAATAAATTAGCAATTAAAGAGTTGA
TTTGTCAGTTTAAGTATTTGAGTGCATTTGAAAAAGATGTCATGTATTTAATGTGTGAACAATATAAGCCGAGAGAAATT
GCTCAATTGATGCATGTAAAAGAGAAAGTGATTTATAATGCCATACAACGATGTAAAAATAAAATAAAACGTTATTTCAA
AATGATTTGA
TTGAAATATGATTTGACAACTCAAGACAGTACAATCAAACGTAACAATTCAATAAATGATAAAGACTTCGAAAAGTTAGT
AATGGATCTACAACCATTAATTATTCGACGCATCAAAACATTTGGATTTAATCATTATGATTTAGAAGACTTATATCAAG
AAATACTTATACGGATGTATAGGTCGGTCCAAACATTTGATTTTAGTGGAGAGCAGCCTTTCACAAATTATGTTCAATGT
TTAATTACGTCTGTAAAGTATGATTATTTGAGAAAATATTTAGCTACAAATAAAAGAATGGATAATTTGATTAATGAATA
TAGAGTTACGTATCCATGTGCAATAAAGCGTTTTGATGTTGAAAACAATTATTTGAATAAATTAGCAATTAAAGAGTTGA
TTTGTCAGTTTAAGTATTTGAGTGCATTTGAAAAAGATGTCATGTATTTAATGTGTGAACAATATAAGCCGAGAGAAATT
GCTCAATTGATGCATGTAAAAGAGAAAGTGATTTATAATGCCATACAACGATGTAAAAATAAAATAAAACGTTATTTCAA
AATGATTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sigH | Staphylococcus aureus MW2 |
97.884 |
100 |
0.979 |
Multiple sequence alignment
References
| [1] | Shi Yuan Feng et al. (2023) The complex regulation of competence in Staphylococcus aureus under microaerobic conditions. Communications Biology 6(1):512. [PMID: 37173437] |
| [2] | Annette Fagerlund et al. (2014) Staphylococcus aureus competence genes: mapping of the SigH, ComK1 and ComK2 regulons by transcriptome sequencing. Molecular Microbiology 94(3):557-79. [PMID: 25155269] |
| [3] | Kazuya Morikawa et al. (2012) Expression of a cryptic secondary sigma factor gene unveils natural competence for DNA transformation in Staphylococcus aureus. PLoS Pathogens 8(11):e1003003. [PMID: 23133387] |
| [4] | Kazuya Morikawa et al. (2003) A new staphylococcal sigma factor in the conserved gene cassette: functional significance and implication for the evolutionary processes. Genes To Cells : Devoted To Molecular & Cellular Mechanisms 8(8):699-712. [PMID: 12875655] |