Detailed information NTG0000013

Experimentally validated

Overview

• Name: sigH
• Type: Regulator
• Locus tag: SA_RS02890
• Genome accession: NC_002745
• Coordinates: 574310..574879 (+)
• Length: 189 a.a.
• NCBI ID: WP_000872882.1
• Uniprot ID: A0A7U7EXA1
• Organism: Staphylococcus aureus N315
• Function: promote expression of competence genes Competence regulation

Function

An over-expression of this sigma factor in S. aureus resulted in a drastic induction of the expression of the com operons that encode proteins required for the natural genetic competence.

Genomic Context

Location: 569310..579879

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SA_RS02865 (SA0487)	cysE	570523..571170 (+)	648	WP_001805237.1	serine O-acetyltransferase	-
SA_RS02870 (SA0488)	cysS	571154..572554 (+)	1401	WP_000631969.1	cysteine--tRNA ligase	-
SA_RS02875 (SA0489)	-	572547..572951 (+)	405	WP_000370182.1	Mini-ribonuclease 3	-
SA_RS02880 (SA0490)	rlmB	572959..573705 (+)	747	WP_000390332.1	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	-
SA_RS02885 (SA0491)	-	573705..574229 (+)	525	WP_000664737.1	NYN domain-containing protein	-
SA_RS02890 (SA0492)	sigH	574310..574879 (+)	570	WP_000872882.1	sigma-70 family RNA polymerase sigma factor	Regulator
SA_RS14515	rpmG	574994..575137 (+)	144	WP_001788193.1	50S ribosomal protein L33	-
SA_RS02895 (SA0493)	secE	575193..575375 (+)	183	WP_001074473.1	preprotein translocase subunit SecE	-
SA_RS02900 (SA0494)	nusG	575388..575936 (+)	549	WP_001288302.1	transcription termination/antitermination protein NusG	-
SA_RS02905 (SA0495)	rplK	576117..576539 (+)	423	WP_001085792.1	50S ribosomal protein L11	-
SA_RS02910 (SA0496)	rplA	576747..577439 (+)	693	WP_001074622.1	50S ribosomal protein L1	-
SA_RS02915 (SA0497)	rplJ	577711..578211 (+)	501	WP_001273085.1	50S ribosomal protein L10	-
SA_RS02920 (SA0498)	rplL	578254..578622 (+)	369	WP_001273586.1	50S ribosomal protein L7/L12	-
SA_RS02925 (SA0499)	-	578797..579405 (+)	609	WP_000020304.1	class I SAM-dependent methyltransferase	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
sigH	comGD	positive effect
agrC	comGD	positive effect
agrC	comGB	positive effect
agrC	comGC	positive effect
agrC	comGE	positive effect
agrC	comGA	positive effect
agrC	comGF	positive effect
braS	comGD	positive effect
braS	comGB	positive effect
braS	comGC	positive effect
braS	comGE	positive effect
braS	comGA	positive effect
braS	comGF	positive effect
sigH	comGA	positive effect
sigH	comGF	positive effect
sigH	comGC	positive effect
sigH	comGE	positive effect
sigH	coiA	positive effect
sigH		positive effect
sigH	comEA	positive effect
sigH	ssb	positive effect
sigH	comGB	positive effect
sigH	dprA	positive effect
braR	comGD	positive effect
braR	comGB	positive effect
braR	comGA	positive effect
braR	comGF	positive effect
braR	comGC	positive effect
braR	comGE	positive effect
vraR	comGD	negative effect
vraR	comGA	negative effect
vraR	comGF	negative effect
vraR	comGB	negative effect
vraR	comGC	negative effect
vraR	comGE	negative effect
agrA	comGD	positive effect
agrA	comGA	positive effect
agrA	comGF	positive effect
agrA	comGB	positive effect
agrA	comGC	positive effect
agrA	comGE	positive effect
comK/comK1	comGD	positive effect
comK/comK1	comGE	positive effect
comK/comK1	coiA	positive effect
comK/comK1		positive effect
comK/comK1	comEA	positive effect
comK/comK1	ssb	positive effect
comK/comK1	comGB	positive effect
comK/comK1	dprA	positive effect
comK/comK1	comGA	positive effect
comK/comK1	comGF	positive effect
comK/comK1	comGC	positive effect
vraS	comGD	negative effect
vraS	comGC	negative effect
vraS	comGE	negative effect
vraS	comGA	negative effect
vraS	comGF	negative effect
vraS	comGB	negative effect

Sequence

Protein

• Length: 189 a.a.
• Molecular weight: 23044.91 Da
• Isoelectric Point: 9.4170

>NTDB_id=13 SA_RS02890 WP_000872882.1 574310..574879(+) (sigH) [Staphylococcus aureus N315]
MKYDLTTQDSTIKRNNSINDKDFEKLVMDLQPLIIRRIKTFGFNHYDLEDLYQEILIRMYRSVQTFDFSGEQPFTNYVQC
LITSVKYDYLRKYLATNKRMDNLINEYRVTYPCAIKRFDVENNYLNKLAIKELICQFKYLSAFEKDVMYLMCEQYKPREI
AQLMHVKEKVIYNAIQRCKNKIKRYFKMI

Nucleotide

• Length: 570 bp

>NTDB_id=13 SA_RS02890 WP_000872882.1 574310..574879(+) (sigH) [Staphylococcus aureus N315]
TTGAAATATGATTTGACAACTCAAGACAGTACAATCAAACGTAACAATTCAATAAATGATAAAGACTTCGAAAAGTTAGT
AATGGATCTACAACCATTAATTATTCGACGCATCAAAACATTTGGATTTAATCATTATGATTTAGAAGACTTATATCAAG
AAATACTTATACGGATGTATAGGTCGGTCCAAACATTTGATTTTAGTGGAGAGCAGCCTTTCACAAATTATGTTCAATGT
TTAATTACGTCTGTAAAGTATGATTATTTGAGAAAATATTTAGCTACAAATAAAAGAATGGATAATTTGATTAATGAATA
TAGAGTTACGTATCCATGTGCAATAAAGCGTTTTGATGTTGAAAACAATTATTTGAATAAATTAGCAATTAAAGAGTTGA
TTTGTCAGTTTAAGTATTTGAGTGCATTTGAAAAAGATGTCATGTATTTAATGTGTGAACAATATAAGCCGAGAGAAATT
GCTCAATTGATGCATGTAAAAGAGAAAGTGATTTATAATGCCATACAACGATGTAAAAATAAAATAAAACGTTATTTCAA
AATGATTTGA

Domains

Predicted by InterproScan.

• Sigma-70 region 2 (Sigma70_r2) (26-92)

3D structure

• AlphaFold DB: A0A7U7EXA1

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
sigH	Staphylococcus aureus MW2	97.884	100	0.979

References

• [1]: Shi Yuan Feng et al. (2023) The complex regulation of competence in Staphylococcus aureus under microaerobic conditions. Communications Biology 6(1):512. [PMID: 37173437]
• [2]: Annette Fagerlund et al. (2014) Staphylococcus aureus competence genes: mapping of the SigH, ComK1 and ComK2 regulons by transcriptome sequencing. Molecular Microbiology 94(3):557-79. [PMID: 25155269]
• [3]: Kazuya Morikawa et al. (2012) Expression of a cryptic secondary sigma factor gene unveils natural competence for DNA transformation in Staphylococcus aureus. PLoS Pathogens 8(11):e1003003. [PMID: 23133387]
• [4]: Kazuya Morikawa et al. (2003) A new staphylococcal sigma factor in the conserved gene cassette: functional significance and implication for the evolutionary processes. Genes To Cells : Devoted To Molecular & Cellular Mechanisms 8(8):699-712. [PMID: 12875655]