Detailed information
Overview
| Name | comGF | Type | Machinery gene |
| Locus tag | SA_RS07750 | Genome accession | NC_002745 |
| Coordinates | 1577707..1578204 (-) | Length | 165 a.a. |
| NCBI ID | WP_001788897.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus N315 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus DNA binding and uptake |
||
Genomic Context
Location: 1572707..1583204
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SA_RS07725 (SA1365) | gcvPB | 1572869..1574341 (-) | 1473 | WP_000202188.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPB | - |
| SA_RS07730 (SA1366) | gcvPA | 1574334..1575680 (-) | 1347 | WP_000019691.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| SA_RS07735 (SA1367) | gcvT | 1575700..1576791 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SA_RS07740 (SA1368) | - | 1576950..1577474 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| SA_RS07745 | - | 1577464..1577610 (-) | 147 | WP_001792109.1 | hypothetical protein | - |
| SA_RS07750 | comGF | 1577707..1578204 (-) | 498 | WP_001788897.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SA_RS07755 (SA1370) | comGE | 1578122..1578421 (-) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| SA_RS07760 (SA1371) | comGD | 1578408..1578854 (-) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SA_RS07765 (SA1372) | comGC | 1578832..1579143 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SA_RS07770 (SA1373) | comGB | 1579157..1580227 (-) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SA_RS07775 (SA1374) | comGA | 1580199..1581173 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SA_RS07780 (SA1375) | - | 1581225..1581848 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| SA_RS07785 (SA1376) | - | 1581845..1582174 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| SA_RS07790 (SA1377) | - | 1582174..1583160 (-) | 987 | WP_000161311.1 | ROK family glucokinase | - |
Regulatory network
Positive effect
Negative effect
| Regulator | Target | Regulation |
|---|---|---|
| agrA | comGF | positive effect |
| agrA | comGA | positive effect |
| comK/comK1 | comGA | positive effect |
| vraR | comGA | negative effect |
| vraS | comGA | negative effect |
| sigH | comGA | positive effect |
| agrC | comGA | positive effect |
| braS | comGA | positive effect |
| braR | comGA | positive effect |
| comK/comK1 | comGF | positive effect |
| vraR | comGF | negative effect |
| vraS | comGF | negative effect |
| sigH | comGF | positive effect |
| agrC | comGF | positive effect |
| braS | comGF | positive effect |
| braR | comGF | positive effect |
| agrA | comGB | positive effect |
| braR | comGB | positive effect |
| sigH | comGB | positive effect |
| agrC | comGB | positive effect |
| braS | comGB | positive effect |
| vraS | comGB | negative effect |
| comK/comK1 | comGB | positive effect |
| vraR | comGB | negative effect |
| agrA | comGC | positive effect |
| vraS | comGC | negative effect |
| comK/comK1 | comGC | positive effect |
| vraR | comGC | negative effect |
| braR | comGC | positive effect |
| sigH | comGC | positive effect |
| agrC | comGC | positive effect |
| braS | comGC | positive effect |
| agrA | comGE | positive effect |
| vraS | comGE | negative effect |
| comK/comK1 | comGE | positive effect |
| vraR | comGE | negative effect |
| braR | comGE | positive effect |
| sigH | comGE | positive effect |
| agrC | comGE | positive effect |
| braS | comGE | positive effect |
| agrA | comGD | positive effect |
| agrC | comGD | positive effect |
| braS | comGD | positive effect |
| sigH | comGD | positive effect |
| braR | comGD | positive effect |
| vraR | comGD | negative effect |
| comK/comK1 | comGD | positive effect |
| vraS | comGD | negative effect |
| comK/comK1 | coiA | positive effect |
| sigH | coiA | positive effect |
| comK/comK1 | positive effect |
|
| sigH | positive effect |
|
| comK/comK1 | comEA | positive effect |
| sigH | comEA | positive effect |
| comK/comK1 | ssb | positive effect |
| sigH | ssb | positive effect |
| comK/comK1 | dprA | positive effect |
| sigH | dprA | positive effect |
Sequence
Protein
Download Length: 165 a.a. Molecular weight: 19181.99 Da Isoelectric Point: 10.1964
>NTDB_id=19 SA_RS07750 WP_001788897.1 1577707..1578204(-) (comGF) [Staphylococcus aureus N315]
MILSKVTNKFVLFQKIPLLIKRHVYSINVKAFSLIEMLVAMMVISIILLIVPDLIRLSKTFLIESRELTTVDFEFFSRDI
LEDFKGVDKNDIEIRQQRIILHKGEEMIEYKLINNKIIKVVNDRGNITMINNVTAFTANIYYKSIIKITITVKVGTNLQT
KTIYV
MILSKVTNKFVLFQKIPLLIKRHVYSINVKAFSLIEMLVAMMVISIILLIVPDLIRLSKTFLIESRELTTVDFEFFSRDI
LEDFKGVDKNDIEIRQQRIILHKGEEMIEYKLINNKIIKVVNDRGNITMINNVTAFTANIYYKSIIKITITVKVGTNLQT
KTIYV
Nucleotide
Download Length: 498 bp
>NTDB_id=19 SA_RS07750 WP_001788897.1 1577707..1578204(-) (comGF) [Staphylococcus aureus N315]
ATGATATTAAGCAAAGTGACCAACAAATTTGTGCTATTTCAAAAAATACCACTTCTTATCAAAAGACATGTATACAGTAT
TAATGTCAAAGCTTTTTCGCTTATTGAAATGTTAGTAGCGATGATGGTTATAAGTATAATTTTACTAATTGTTCCAGACT
TAATTAGACTTAGCAAAACTTTTCTAATTGAAAGTAGGGAATTAACAACTGTAGATTTCGAATTTTTCTCAAGAGATATT
CTAGAGGATTTTAAAGGTGTAGATAAAAACGATATTGAAATTAGGCAACAGCGTATCATTTTACATAAAGGTGAAGAAAT
GATCGAATACAAATTAATAAATAATAAAATTATTAAAGTTGTAAATGACAGAGGAAATATAACAATGATTAATAATGTTA
CAGCATTTACTGCAAATATCTACTATAAATCTATTATTAAAATAACGATAACAGTTAAAGTCGGTACAAATCTGCAGACT
AAAACTATTTATGTATAA
ATGATATTAAGCAAAGTGACCAACAAATTTGTGCTATTTCAAAAAATACCACTTCTTATCAAAAGACATGTATACAGTAT
TAATGTCAAAGCTTTTTCGCTTATTGAAATGTTAGTAGCGATGATGGTTATAAGTATAATTTTACTAATTGTTCCAGACT
TAATTAGACTTAGCAAAACTTTTCTAATTGAAAGTAGGGAATTAACAACTGTAGATTTCGAATTTTTCTCAAGAGATATT
CTAGAGGATTTTAAAGGTGTAGATAAAAACGATATTGAAATTAGGCAACAGCGTATCATTTTACATAAAGGTGAAGAAAT
GATCGAATACAAATTAATAAATAATAAAATTATTAAAGTTGTAAATGACAGAGGAAATATAACAATGATTAATAATGTTA
CAGCATTTACTGCAAATATCTACTATAAATCTATTATTAAAATAACGATAACAGTTAAAGTCGGTACAAATCTGCAGACT
AAAACTATTTATGTATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGF | Staphylococcus aureus MW2 |
96.364 |
100 |
0.964 |
Multiple sequence alignment
References
| [1] | Mais Maree et al. (2022) Natural transformation allows transfer of SCCmec-mediated methicillin resistance in Staphylococcus aureus biofilms. Nature Communications 13(1):2477. [PMID: 35513365] |
| [2] | Annette Fagerlund et al. (2014) Staphylococcus aureus competence genes: mapping of the SigH, ComK1 and ComK2 regulons by transcriptome sequencing. Molecular Microbiology 94(3):557-79. [PMID: 25155269] |
| [3] | Kazuya Morikawa et al. (2003) A new staphylococcal sigma factor in the conserved gene cassette: functional significance and implication for the evolutionary processes. Genes To Cells : Devoted To Molecular & Cellular Mechanisms 8(8):699-712. [PMID: 12875655] |