Detailed information    

experimental Experimentally validated

Overview


Name   comK/comK1   Type   Regulator
Locus tag   SA_RS04995 Genome accession   NC_002745
Coordinates   1002938..1003507 (-) Length   189 a.a.
NCBI ID   WP_000287265.1    Uniprot ID   -
Organism   Staphylococcus aureus N315     
Function   promote expression of competence genes   
Competence regulation

Function


ComK1 plays a role in regulating transcription of competence genes in S. aureus.


Genomic Context


Location: 997938..1008507
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SA_RS04975 (SA0880) - 999443..1000801 (+) 1359 WP_000021865.1 TrkH family potassium uptake protein -
  SA_RS04980 (SA0881) - 1000940..1002451 (+) 1512 WP_000414165.1 bifunctional metallophosphatase/5'-nucleotidase -
  SA_RS04995 (SA0882) comK/comK1 1002938..1003507 (-) 570 WP_000287265.1 competence protein ComK Regulator
  SA_RS05000 (SA0883) - 1003717..1003935 (+) 219 WP_000876826.1 IDEAL domain-containing protein -
  SA_RS05005 (SA0884) - 1004016..1005002 (-) 987 WP_000668818.1 lipoate--protein ligase -
  SA_RS05010 (SAS027) - 1005201..1005377 (+) 177 WP_000214898.1 YkvS family protein -
  SA_RS05015 (SA0885) - 1005392..1005994 (+) 603 WP_001033865.1 type II CAAX prenyl endopeptidase Rce1 family protein -
  SA_RS15370 - 1006309..1006371 (+) 63 WP_228764722.1 hypothetical protein -
  SA_RS05025 - 1006910..1007011 (+) 102 WP_001792055.1 hypothetical protein -
  SA_RS14630 - 1007021..1007293 (+) 273 WP_001797239.1 lactococcin 972 family bacteriocin -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  comK/comK1 comGE positive effect
  vraS comGE negative effect
  vraS comGC negative effect
  vraS comGD negative effect
  vraS comGA negative effect
  vraS comGF negative effect
  vraS comGB negative effect
  agrA comGC positive effect
  agrA comGA positive effect
  agrA comGF positive effect
  agrA comGB positive effect
  agrA comGE positive effect
  agrA comGD positive effect
  comK/comK1 comGC positive effect
  comK/comK1 coiA positive effect
  comK/comK1 positive effect
  comK/comK1 comGD positive effect
  comK/comK1 comEA positive effect
  comK/comK1 ssb positive effect
  comK/comK1 comGB positive effect
  comK/comK1 dprA positive effect
  comK/comK1 comGA positive effect
  comK/comK1 comGF positive effect
  vraR comGC negative effect
  vraR comGA negative effect
  vraR comGF negative effect
  vraR comGB negative effect
  vraR comGE negative effect
  vraR comGD negative effect
  braR comGC positive effect
  braR comGB positive effect
  braR comGD positive effect
  braR comGA positive effect
  braR comGF positive effect
  braR comGE positive effect
  sigH comGC positive effect
  sigH comGD positive effect
  sigH comGA positive effect
  sigH comGF positive effect
  sigH comGE positive effect
  sigH coiA positive effect
  sigH positive effect
  sigH comEA positive effect
  sigH ssb positive effect
  sigH comGB positive effect
  sigH dprA positive effect
  agrC comGC positive effect
  agrC comGD positive effect
  agrC comGB positive effect
  agrC comGE positive effect
  agrC comGA positive effect
  agrC comGF positive effect
  braS comGC positive effect
  braS comGD positive effect
  braS comGB positive effect
  braS comGE positive effect
  braS comGA positive effect
  braS comGF positive effect

Sequence


Protein


Download         Length: 189 a.a.        Molecular weight: 22601.83 Da        Isoelectric Point: 9.6091

>NTDB_id=23 SA_RS04995 WP_000287265.1 1002938..1003507(-) (comK/comK1) [Staphylococcus aureus N315]
MYSQNIYVIRKGDMVIRPAFDDDDQRNGSEIIRFDKTRIQNPFKVQKIIERSCKFYGNTYLGKKAETNRITGISSKPPIL
LTPLFPTYFFPTHSDRQNENIWLNMHYIESIKELKNRKCKVTFINNESIILHVSYHSLWHQYNNSIFYYYMVDKQSRMIS
KNPDQPIDYNKATLNVFEALTRYSLFEDK

Nucleotide


Download         Length: 570 bp        

>NTDB_id=23 SA_RS04995 WP_000287265.1 1002938..1003507(-) (comK/comK1) [Staphylococcus aureus N315]
ATGTATTCTCAAAATATTTATGTGATACGCAAAGGAGACATGGTTATTCGACCAGCATTTGATGATGACGATCAAAGAAA
CGGTAGTGAAATAATTCGGTTTGACAAAACGCGTATTCAAAATCCTTTTAAAGTCCAGAAAATCATTGAACGCTCTTGCA
AATTTTATGGTAATACTTATCTTGGCAAGAAAGCAGAGACAAACCGCATTACTGGCATTTCTAGTAAACCACCTATTTTA
CTAACACCATTATTTCCAACTTATTTTTTCCCAACACATTCTGACAGACAAAATGAAAATATTTGGTTAAATATGCATTA
TATCGAAAGTATTAAAGAATTAAAAAATCGTAAATGTAAAGTGACATTTATTAATAATGAATCTATCATTCTTCATGTTT
CATACCACAGTTTATGGCATCAATATAACAATTCCATTTTTTACTATTACATGGTAGATAAACAATCTCGCATGATATCA
AAAAATCCCGACCAACCAATAGATTATAATAAAGCCACATTGAATGTGTTTGAAGCATTGACACGCTATTCTTTATTTGA
AGATAAATAA

Domains


Predicted by InterProScan.

(5-156)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

100

100

1


Multiple sequence alignment    



References


[1] Shi Yuan Feng et al. (2023) The complex regulation of competence in Staphylococcus aureus under microaerobic conditions. Communications Biology 6(1):512. [PMID: 37173437]
[2] Annette Fagerlund et al. (2014) Staphylococcus aureus competence genes: mapping of the SigH, ComK1 and ComK2 regulons by transcriptome sequencing. Molecular Microbiology 94(3):557-79. [PMID: 25155269]