Detailed information    

experimental Experimentally validated

Overview


Name   comGA   Type   Machinery gene
Locus tag   SA_RS07775 Genome accession   NC_002745
Coordinates   1580199..1581173 (-) Length   324 a.a.
NCBI ID   WP_000697220.1    Uniprot ID   -
Organism   Staphylococcus aureus N315     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus   
DNA binding and uptake

Function


The comGA gene encodes an ATPase that is located on the inside of the cytoplasmic membrane, while comGB codes for a polytopic membrane protein. ComGA and ComGB play important roles in assembly and function of the transformation pilus.


Genomic Context


Location: 1575199..1586173
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SA_RS07735 (SA1367) gcvT 1575700..1576791 (-) 1092 WP_000093349.1 glycine cleavage system aminomethyltransferase GcvT -
  SA_RS07740 (SA1368) - 1576950..1577474 (-) 525 WP_001015120.1 shikimate kinase -
  SA_RS07745 - 1577464..1577610 (-) 147 WP_001792109.1 hypothetical protein -
  SA_RS07750 comGF 1577707..1578204 (-) 498 WP_001788897.1 competence type IV pilus minor pilin ComGF Machinery gene
  SA_RS07755 (SA1370) comGE 1578122..1578421 (-) 300 WP_000844410.1 hypothetical protein Machinery gene
  SA_RS07760 (SA1371) comGD 1578408..1578854 (-) 447 WP_001788899.1 competence type IV pilus minor pilin ComGD Machinery gene
  SA_RS07765 (SA1372) comGC 1578832..1579143 (-) 312 WP_000472256.1 competence type IV pilus major pilin ComGC Machinery gene
  SA_RS07770 (SA1373) comGB 1579157..1580227 (-) 1071 WP_000776422.1 competence type IV pilus assembly protein ComGB Machinery gene
  SA_RS07775 (SA1374) comGA 1580199..1581173 (-) 975 WP_000697220.1 competence type IV pilus ATPase ComGA Machinery gene
  SA_RS07780 (SA1375) - 1581225..1581848 (-) 624 WP_001223008.1 MBL fold metallo-hydrolase -
  SA_RS07785 (SA1376) - 1581845..1582174 (-) 330 WP_001018871.1 MTH1187 family thiamine-binding protein -
  SA_RS07790 (SA1377) - 1582174..1583160 (-) 987 WP_000161311.1 ROK family glucokinase -
  SA_RS07795 (SA1378) - 1583157..1583360 (-) 204 WP_000087561.1 YqgQ family protein -
  SA_RS07800 (SA1379) - 1583341..1584804 (-) 1464 WP_001017867.1 rhomboid family protein -
  SA_RS07805 (SA1380) - 1584816..1585355 (-) 540 WP_000164546.1 5-formyltetrahydrofolate cyclo-ligase -
  SA_RS07810 (SAS047) rpmG 1585564..1585713 (-) 150 WP_001265709.1 50S ribosomal protein L33 -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  agrA comGA positive effect
  comK/comK1 comGA positive effect
  vraR comGA negative effect
  vraS comGA negative effect
  sigH comGA positive effect
  agrC comGA positive effect
  braS comGA positive effect
  braR comGA positive effect
  agrA comGF positive effect
  comK/comK1 comGF positive effect
  vraR comGF negative effect
  vraS comGF negative effect
  sigH comGF positive effect
  agrC comGF positive effect
  braS comGF positive effect
  braR comGF positive effect
  agrA comGB positive effect
  braR comGB positive effect
  sigH comGB positive effect
  agrC comGB positive effect
  braS comGB positive effect
  vraS comGB negative effect
  comK/comK1 comGB positive effect
  vraR comGB negative effect
  agrA comGC positive effect
  vraS comGC negative effect
  comK/comK1 comGC positive effect
  vraR comGC negative effect
  braR comGC positive effect
  sigH comGC positive effect
  agrC comGC positive effect
  braS comGC positive effect
  agrA comGE positive effect
  vraS comGE negative effect
  comK/comK1 comGE positive effect
  vraR comGE negative effect
  braR comGE positive effect
  sigH comGE positive effect
  agrC comGE positive effect
  braS comGE positive effect
  agrA comGD positive effect
  agrC comGD positive effect
  braS comGD positive effect
  sigH comGD positive effect
  braR comGD positive effect
  vraR comGD negative effect
  comK/comK1 comGD positive effect
  vraS comGD negative effect
  comK/comK1 coiA positive effect
  sigH coiA positive effect
  comK/comK1 positive effect
  sigH positive effect
  comK/comK1 comEA positive effect
  sigH comEA positive effect
  comK/comK1 ssb positive effect
  sigH ssb positive effect
  comK/comK1 dprA positive effect
  sigH dprA positive effect

Sequence


Protein


Download         Length: 324 a.a.        Molecular weight: 36897.96 Da        Isoelectric Point: 8.8516

>NTDB_id=14 SA_RS07775 WP_000697220.1 1580199..1581173(-) (comGA) [Staphylococcus aureus N315]
MKILFQEIINKAIEMKASDVHFIPVKNEVSIKFRINDNLEQYEQIGNSIYQKLLVYMKFQAGLDVSTQQVAQSGRYSYHF
NKIYFLRISTLPLSLGQESCVIRIVPQFFQQQKSTYKFNDFKHLMNKKQGLLLFSGPTGSGKSTLMYQMVSYANKALNLN
VISIEDPVEMQIPGIVQINVNDKAGINYVNSFKAILRCDPDVILIGEIRDKDVAKCVIQASLSGHLVLTTLHATDCKGAI
LRLLEMGISVQELIQATNLIINQRLVTTIKQQRQLVCEILSQQQLRYFFSHNHSLPSSFKNLEDKLDDMTKAGVICETTM
DKYI

Nucleotide


Download         Length: 975 bp        

>NTDB_id=14 SA_RS07775 WP_000697220.1 1580199..1581173(-) (comGA) [Staphylococcus aureus N315]
TTGAAGATTCTATTTCAAGAAATAATTAATAAAGCGATAGAAATGAAAGCGAGTGATGTACATTTTATTCCAGTTAAAAA
TGAAGTAAGTATTAAATTTAGAATTAATGATAACTTGGAGCAGTATGAACAAATTGGGAATAGCATTTATCAAAAGTTAT
TAGTTTATATGAAGTTTCAAGCTGGGCTTGATGTTTCTACACAGCAAGTCGCACAGAGCGGTCGATATAGTTACCATTTC
AATAAAATATATTTTTTGAGAATATCAACTTTACCATTGTCACTTGGCCAAGAAAGTTGTGTTATCAGAATTGTACCTCA
ATTTTTTCAACAACAGAAATCAACTTATAAATTCAATGATTTTAAACACCTCATGAATAAGAAACAAGGATTACTATTGT
TTAGTGGGCCAACTGGTTCAGGAAAGAGTACATTAATGTATCAAATGGTCTCATACGCGAATAAAGCCTTGAATTTAAAT
GTAATTTCTATAGAGGATCCTGTAGAGATGCAAATTCCTGGTATCGTCCAAATTAATGTGAATGATAAAGCTGGCATTAA
CTATGTAAATTCGTTTAAAGCTATTTTAAGATGTGATCCTGATGTTATTTTAATAGGTGAAATCAGAGATAAAGATGTTG
CCAAGTGTGTTATACAGGCTAGTTTAAGTGGTCACCTTGTTCTGACTACATTGCATGCAACTGATTGTAAAGGTGCTATT
TTAAGGCTATTAGAAATGGGCATTTCTGTACAAGAATTGATACAGGCAACTAACTTAATTATAAACCAACGACTTGTAAC
TACTATTAAGCAACAGCGACAATTAGTATGCGAAATTCTATCTCAGCAACAACTCCGATATTTCTTTTCCCATAATCATT
CATTACCATCATCATTTAAGAACTTAGAAGATAAACTTGATGATATGACAAAAGCAGGTGTCATTTGTGAAACTACAATG
GATAAATACATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGA Staphylococcus aureus MW2

100

100

1


Multiple sequence alignment    



References


[1] Shi Yuan Feng et al. (2023) The complex regulation of competence in Staphylococcus aureus under microaerobic conditions. Communications Biology 6(1):512. [PMID: 37173437]
[2] Fedy Morgene et al. (2023) Natural transformation and cell division delay in competent Staphylococcus aureus. Microbiology Spectrum 11(6):e0280723. [PMID: 37831481]
[3] Mais Maree et al. (2022) Natural transformation allows transfer of SCCmec-mediated methicillin resistance in Staphylococcus aureus biofilms. Nature Communications 13(1):2477. [PMID: 35513365]
[4] Annette Fagerlund et al. (2014) Staphylococcus aureus competence genes: mapping of the SigH, ComK1 and ComK2 regulons by transcriptome sequencing. Molecular Microbiology 94(3):557-79. [PMID: 25155269]
[5] Kazuya Morikawa et al. (2003) A new staphylococcal sigma factor in the conserved gene cassette: functional significance and implication for the evolutionary processes. Genes To Cells : Devoted To Molecular & Cellular Mechanisms 8(8):699-712. [PMID: 12875655]