Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | SA_RS10930 | Genome accession | NC_002745 |
| Coordinates | 2151442..2151837 (-) | Length | 131 a.a. |
| NCBI ID | WP_000932694.1 | Uniprot ID | Q2FWF7 |
| Organism | Staphylococcus aureus N315 | ||
| Function | ssDNA binding DNA processing |
||
Genomic Context
Location: 2146442..2156837
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SA_RS10900 (SA1894) | thiE | 2147041..2147682 (-) | 642 | WP_000483153.1 | thiamine phosphate synthase | - |
| SA_RS10905 (SA1895) | thiM | 2147684..2148475 (-) | 792 | WP_001108483.1 | hydroxyethylthiazole kinase | - |
| SA_RS10910 (SA1896) | thiD | 2148459..2149289 (-) | 831 | WP_000594954.1 | bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase | - |
| SA_RS10915 (SA1897) | tenA | 2149282..2149971 (-) | 690 | WP_000396077.1 | thiaminase II | - |
| SA_RS10925 (SA1898) | sceD | 2150358..2151053 (-) | 696 | WP_000752005.1 | lytic transglycosylase SceD | - |
| SA_RS10930 (SA1899) | ssb | 2151442..2151837 (-) | 396 | WP_000932694.1 | single-stranded DNA-binding protein | Machinery gene |
| SA_RS10935 (SA1900) | - | 2152031..2152471 (+) | 441 | WP_000846746.1 | YwpF-like family protein | - |
| SA_RS10940 (SA1901) | fabZ | 2152530..2152970 (-) | 441 | WP_000447678.1 | 3-hydroxyacyl-ACP dehydratase FabZ | - |
| SA_RS10945 (SA1902) | murA | 2153004..2154269 (-) | 1266 | WP_000358006.1 | UDP-N-acetylglucosamine 1-carboxyvinyltransferase | - |
| SA_RS10950 (SA1903) | - | 2154380..2154613 (-) | 234 | WP_000384523.1 | DUF1146 family protein | - |
| SA_RS10955 | - | 2154745..2154837 (-) | 93 | WP_001790611.1 | hypothetical protein | - |
| SA_RS10960 (SA1904) | - | 2155175..2155579 (-) | 405 | WP_001094394.1 | F0F1 ATP synthase subunit epsilon | - |
Regulatory network
Positive effect
Negative effect
| Regulator | Target | Regulation |
|---|---|---|
| sigH | ssb | positive effect |
| sigH | comGD | positive effect |
| agrC | comGD | positive effect |
| braS | comGD | positive effect |
| braR | comGD | positive effect |
| vraR | comGD | negative effect |
| agrA | comGD | positive effect |
| comK/comK1 | comGD | positive effect |
| vraS | comGD | negative effect |
| agrC | comGB | positive effect |
| braR | comGB | positive effect |
| sigH | comGB | positive effect |
| braS | comGB | positive effect |
| vraS | comGB | negative effect |
| agrA | comGB | positive effect |
| comK/comK1 | comGB | positive effect |
| vraR | comGB | negative effect |
| agrC | comGC | positive effect |
| vraS | comGC | negative effect |
| agrA | comGC | positive effect |
| comK/comK1 | comGC | positive effect |
| vraR | comGC | negative effect |
| braR | comGC | positive effect |
| sigH | comGC | positive effect |
| braS | comGC | positive effect |
| agrC | comGE | positive effect |
| vraS | comGE | negative effect |
| agrA | comGE | positive effect |
| comK/comK1 | comGE | positive effect |
| vraR | comGE | negative effect |
| braR | comGE | positive effect |
| sigH | comGE | positive effect |
| braS | comGE | positive effect |
| agrC | comGA | positive effect |
| agrA | comGA | positive effect |
| comK/comK1 | comGA | positive effect |
| vraR | comGA | negative effect |
| vraS | comGA | negative effect |
| sigH | comGA | positive effect |
| braS | comGA | positive effect |
| braR | comGA | positive effect |
| agrC | comGF | positive effect |
| agrA | comGF | positive effect |
| comK/comK1 | comGF | positive effect |
| vraR | comGF | negative effect |
| vraS | comGF | negative effect |
| sigH | comGF | positive effect |
| braS | comGF | positive effect |
| braR | comGF | positive effect |
| sigH | coiA | positive effect |
| comK/comK1 | coiA | positive effect |
| sigH | positive effect |
|
| comK/comK1 | positive effect |
|
| sigH | comEA | positive effect |
| comK/comK1 | comEA | positive effect |
| comK/comK1 | ssb | positive effect |
| sigH | dprA | positive effect |
| comK/comK1 | dprA | positive effect |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 15042.09 Da Isoelectric Point: 5.6824
>NTDB_id=28 SA_RS10930 WP_000932694.1 2151442..2151837(-) (ssb) [Staphylococcus aureus N315]
MLNKIVIVGRLTKDAQIFEKEDRKIATFCVATHRNYKDENGEIVCDYLFCKAFGKLASNIEKYTNQGTLVGITGQMRSRK
YDKDGQTHFVTELYVETIKFMSPKSQNNEILSDSILDIDSQNIDNHDLLEI
MLNKIVIVGRLTKDAQIFEKEDRKIATFCVATHRNYKDENGEIVCDYLFCKAFGKLASNIEKYTNQGTLVGITGQMRSRK
YDKDGQTHFVTELYVETIKFMSPKSQNNEILSDSILDIDSQNIDNHDLLEI
Nucleotide
Download Length: 396 bp
>NTDB_id=28 SA_RS10930 WP_000932694.1 2151442..2151837(-) (ssb) [Staphylococcus aureus N315]
ATGCTAAATAAAATCGTAATTGTCGGGAGACTGACGAAAGACGCACAAATATTTGAAAAGGAGGATAGAAAAATTGCAAC
GTTTTGTGTTGCAACGCACCGAAATTATAAAGATGAAAATGGAGAAATCGTCTGTGATTACTTATTCTGTAAAGCATTTG
GCAAGTTAGCTTCTAATATAGAAAAATATACTAATCAAGGTACATTGGTTGGTATAACTGGTCAAATGAGATCAAGAAAG
TATGATAAAGACGGACAAACACACTTTGTCACTGAATTATATGTTGAAACAATAAAATTTATGTCCCCTAAATCCCAAAA
TAATGAAATTCTCTCAGATAGTATTTTAGATATTGACTCTCAAAATATAGATAATCATGACTTATTAGAAATTTAA
ATGCTAAATAAAATCGTAATTGTCGGGAGACTGACGAAAGACGCACAAATATTTGAAAAGGAGGATAGAAAAATTGCAAC
GTTTTGTGTTGCAACGCACCGAAATTATAAAGATGAAAATGGAGAAATCGTCTGTGATTACTTATTCTGTAAAGCATTTG
GCAAGTTAGCTTCTAATATAGAAAAATATACTAATCAAGGTACATTGGTTGGTATAACTGGTCAAATGAGATCAAGAAAG
TATGATAAAGACGGACAAACACACTTTGTCACTGAATTATATGTTGAAACAATAAAATTTATGTCCCCTAAATCCCAAAA
TAATGAAATTCTCTCAGATAGTATTTTAGATATTGACTCTCAAAATATAGATAATCATGACTTATTAGAAATTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Staphylococcus aureus MW2 |
99.237 |
100 |
0.992 |
Multiple sequence alignment
References
| [1] | Annette Fagerlund et al. (2014) Staphylococcus aureus competence genes: mapping of the SigH, ComK1 and ComK2 regulons by transcriptome sequencing. Molecular Microbiology 94(3):557-79. [PMID: 25155269] |