Detailed information    

experimental Experimentally validated

Overview


Name   ssb   Type   Machinery gene
Locus tag   SA_RS10930 Genome accession   NC_002745
Coordinates   2151442..2151837 (-) Length   131 a.a.
NCBI ID   WP_000932694.1    Uniprot ID   Q2FWF7
Organism   Staphylococcus aureus N315     
Function   ssDNA binding   
DNA processing

Function


The incoming ssDNA fragment is coated with SsbB upon entry into the cytoplasm.


Genomic Context


Location: 2146442..2156837
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SA_RS10900 (SA1894) thiE 2147041..2147682 (-) 642 WP_000483153.1 thiamine phosphate synthase -
  SA_RS10905 (SA1895) thiM 2147684..2148475 (-) 792 WP_001108483.1 hydroxyethylthiazole kinase -
  SA_RS10910 (SA1896) thiD 2148459..2149289 (-) 831 WP_000594954.1 bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase -
  SA_RS10915 (SA1897) tenA 2149282..2149971 (-) 690 WP_000396077.1 thiaminase II -
  SA_RS10925 (SA1898) sceD 2150358..2151053 (-) 696 WP_000752005.1 lytic transglycosylase SceD -
  SA_RS10930 (SA1899) ssb 2151442..2151837 (-) 396 WP_000932694.1 single-stranded DNA-binding protein Machinery gene
  SA_RS10935 (SA1900) - 2152031..2152471 (+) 441 WP_000846746.1 YwpF-like family protein -
  SA_RS10940 (SA1901) fabZ 2152530..2152970 (-) 441 WP_000447678.1 3-hydroxyacyl-ACP dehydratase FabZ -
  SA_RS10945 (SA1902) murA 2153004..2154269 (-) 1266 WP_000358006.1 UDP-N-acetylglucosamine 1-carboxyvinyltransferase -
  SA_RS10950 (SA1903) - 2154380..2154613 (-) 234 WP_000384523.1 DUF1146 family protein -
  SA_RS10955 - 2154745..2154837 (-) 93 WP_001790611.1 hypothetical protein -
  SA_RS10960 (SA1904) - 2155175..2155579 (-) 405 WP_001094394.1 F0F1 ATP synthase subunit epsilon -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  sigH ssb positive effect
  sigH comGD positive effect
  agrC comGD positive effect
  braS comGD positive effect
  braR comGD positive effect
  vraR comGD negative effect
  agrA comGD positive effect
  comK/comK1 comGD positive effect
  vraS comGD negative effect
  agrC comGB positive effect
  braR comGB positive effect
  sigH comGB positive effect
  braS comGB positive effect
  vraS comGB negative effect
  agrA comGB positive effect
  comK/comK1 comGB positive effect
  vraR comGB negative effect
  agrC comGC positive effect
  vraS comGC negative effect
  agrA comGC positive effect
  comK/comK1 comGC positive effect
  vraR comGC negative effect
  braR comGC positive effect
  sigH comGC positive effect
  braS comGC positive effect
  agrC comGE positive effect
  vraS comGE negative effect
  agrA comGE positive effect
  comK/comK1 comGE positive effect
  vraR comGE negative effect
  braR comGE positive effect
  sigH comGE positive effect
  braS comGE positive effect
  agrC comGA positive effect
  agrA comGA positive effect
  comK/comK1 comGA positive effect
  vraR comGA negative effect
  vraS comGA negative effect
  sigH comGA positive effect
  braS comGA positive effect
  braR comGA positive effect
  agrC comGF positive effect
  agrA comGF positive effect
  comK/comK1 comGF positive effect
  vraR comGF negative effect
  vraS comGF negative effect
  sigH comGF positive effect
  braS comGF positive effect
  braR comGF positive effect
  sigH coiA positive effect
  comK/comK1 coiA positive effect
  sigH positive effect
  comK/comK1 positive effect
  sigH comEA positive effect
  comK/comK1 comEA positive effect
  comK/comK1 ssb positive effect
  sigH dprA positive effect
  comK/comK1 dprA positive effect

Sequence


Protein


Download         Length: 131 a.a.        Molecular weight: 15042.09 Da        Isoelectric Point: 5.6824

>NTDB_id=28 SA_RS10930 WP_000932694.1 2151442..2151837(-) (ssb) [Staphylococcus aureus N315]
MLNKIVIVGRLTKDAQIFEKEDRKIATFCVATHRNYKDENGEIVCDYLFCKAFGKLASNIEKYTNQGTLVGITGQMRSRK
YDKDGQTHFVTELYVETIKFMSPKSQNNEILSDSILDIDSQNIDNHDLLEI

Nucleotide


Download         Length: 396 bp        

>NTDB_id=28 SA_RS10930 WP_000932694.1 2151442..2151837(-) (ssb) [Staphylococcus aureus N315]
ATGCTAAATAAAATCGTAATTGTCGGGAGACTGACGAAAGACGCACAAATATTTGAAAAGGAGGATAGAAAAATTGCAAC
GTTTTGTGTTGCAACGCACCGAAATTATAAAGATGAAAATGGAGAAATCGTCTGTGATTACTTATTCTGTAAAGCATTTG
GCAAGTTAGCTTCTAATATAGAAAAATATACTAATCAAGGTACATTGGTTGGTATAACTGGTCAAATGAGATCAAGAAAG
TATGATAAAGACGGACAAACACACTTTGTCACTGAATTATATGTTGAAACAATAAAATTTATGTCCCCTAAATCCCAAAA
TAATGAAATTCTCTCAGATAGTATTTTAGATATTGACTCTCAAAATATAGATAATCATGACTTATTAGAAATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q2FWF7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Staphylococcus aureus MW2

99.237

100

0.992


Multiple sequence alignment    



References


[1] Annette Fagerlund et al. (2014) Staphylococcus aureus competence genes: mapping of the SigH, ComK1 and ComK2 regulons by transcriptome sequencing. Molecular Microbiology 94(3):557-79. [PMID: 25155269]