Detailed information    

experimental Experimentally validated

Overview


Name   ssb   Type   Machinery gene
Locus tag   MW_RS11015 Genome accession   NC_003923
Coordinates   2178087..2178482 (-) Length   131 a.a.
NCBI ID   WP_000932692.1    Uniprot ID   -
Organism   Staphylococcus aureus MW2     
Function   ssDNA binding   
DNA processing

Function


The incoming ssDNA fragment is coated with SsbB upon entry into the cytoplasm.


Genomic Context


Location: 2173087..2183482
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MW_RS10985 (MW2014) thiE 2173549..2174190 (-) 642 WP_000483155.1 thiamine phosphate synthase -
  MW_RS10990 (MW2015) thiM 2174183..2174983 (-) 801 WP_001108492.1 hydroxyethylthiazole kinase -
  MW_RS10995 (MW2016) thiD 2174967..2175797 (-) 831 WP_000594960.1 bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase -
  MW_RS11000 (MW2017) tenA 2175790..2176479 (-) 690 WP_000396077.1 thiaminase II -
  MW_RS11010 (MW2020) sceD 2177003..2177698 (-) 696 WP_000752008.1 lytic transglycosylase SceD -
  MW_RS11015 (MW2021) ssb 2178087..2178482 (-) 396 WP_000932692.1 single-stranded DNA-binding protein Machinery gene
  MW_RS11020 (MW2022) - 2178676..2179116 (+) 441 WP_000846746.1 YwpF-like family protein -
  MW_RS11025 (MW2023) fabZ 2179174..2179614 (-) 441 WP_000447678.1 3-hydroxyacyl-ACP dehydratase FabZ -
  MW_RS11030 (MW2024) murA 2179648..2180913 (-) 1266 WP_000358006.1 UDP-N-acetylglucosamine 1-carboxyvinyltransferase -
  MW_RS11035 (MW2025) - 2181024..2181257 (-) 234 WP_000384523.1 DUF1146 family protein -
  MW_RS11040 - 2181389..2181481 (-) 93 WP_031864518.1 hypothetical protein -
  MW_RS11045 (MW2026) - 2181819..2182223 (-) 405 WP_001094394.1 F0F1 ATP synthase subunit epsilon -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  sigH ssb positive effect
  sigH comGD positive effect
  comK/comK1 comGD positive effect
  sigH dprA positive effect
  comK/comK1 dprA positive effect
  sigH comGA positive effect
  comK/comK1 comGA positive effect
  comK/comK1 ssb positive effect
  sigH comGF positive effect
  comK/comK1 comGF positive effect
  sigH comEC positive effect
  comK/comK1 comEC positive effect
  sigH comGB positive effect
  comK/comK1 comGB positive effect
  sigH comEA positive effect
  comK/comK1 comEA positive effect
  sigH comGC positive effect
  comK/comK1 comGC positive effect
  sigH coiA positive effect
  comK/comK1 coiA positive effect
  sigH comGE positive effect
  comK/comK1 comGE positive effect

Sequence


Protein


Download         Length: 131 a.a.        Molecular weight: 15114.16 Da        Isoelectric Point: 5.2452

>NTDB_id=43 MW_RS11015 WP_000932692.1 2178087..2178482(-) (ssb) [Staphylococcus aureus MW2]
MLNKIVIVERLTKDAQIFEKEDRKIATFCVATHRNYKDENGEIVCDYLFCKAFGKLASNIEKYTNQGTLVGITGQMRSRK
YDKDGQTHFVTELYVETIKFMSPKSQNNEILSDSILDIDSQNIDNHDLLEI

Nucleotide


Download         Length: 396 bp        

>NTDB_id=43 MW_RS11015 WP_000932692.1 2178087..2178482(-) (ssb) [Staphylococcus aureus MW2]
ATGCTAAATAAAATCGTAATTGTCGAGAGACTGACGAAAGACGCACAAATATTTGAAAAGGAGGATAGAAAAATTGCAAC
GTTTTGTGTTGCAACGCACCGAAATTATAAAGATGAAAATGGAGAAATCGTCTGTGATTACTTATTCTGTAAAGCATTTG
GCAAGTTAGCTTCTAATATAGAAAAATATACTAATCAAGGTACATTGGTTGGTATAACTGGTCAAATGAGATCAAGAAAG
TATGATAAAGACGGACAAACACACTTTGTCACTGAATTATATGTTGAAACAATAAAATTTATGTCCCCTAAATCCCAAAA
TAATGAAATTCTCTCAGATAGTATTTTAGATATTGACTCTCAAAATATAGATAATCATGACTTATTAGAAATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Staphylococcus aureus N315

99.237

100

0.992


Multiple sequence alignment    



References


[1] Annette Fagerlund et al. (2014) Staphylococcus aureus competence genes: mapping of the SigH, ComK1 and ComK2 regulons by transcriptome sequencing. Molecular Microbiology 94(3):557-79. [PMID: 25155269]