Detailed information    

experimental Experimentally validated

Overview


Name   comGF   Type   Machinery gene
Locus tag   MW_RS07980 Genome accession   NC_003923
Coordinates   1623254..1623751 (-) Length   165 a.a.
NCBI ID   WP_001789864.1    Uniprot ID   A0A0H2XJ03
Organism   Staphylococcus aureus MW2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus   
DNA binding and uptake

Function


In addition, the staphylococcal comG operon contains a homologue to the gene encoding the major pilins of S. pneumoniae and B. subtilis (comGC) and three small open reading frames (comGD, comGE and comGF) encoding minor pilin subunits.


Genomic Context


Location: 1618254..1628751
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MW_RS07955 (MW1487) gcvPB 1618416..1619888 (-) 1473 WP_000202189.1 aminomethyl-transferring glycine dehydrogenase subunit GcvPB -
  MW_RS07960 (MW1488) gcvPA 1619881..1621227 (-) 1347 WP_000019687.1 aminomethyl-transferring glycine dehydrogenase subunit GcvPA -
  MW_RS07965 (MW1489) gcvT 1621247..1622338 (-) 1092 WP_000093349.1 glycine cleavage system aminomethyltransferase GcvT -
  MW_RS07970 (MW1490) - 1622497..1623021 (-) 525 WP_001015121.1 shikimate kinase -
  MW_RS07975 - 1623011..1623157 (-) 147 WP_001789879.1 hypothetical protein -
  MW_RS07980 comGF 1623254..1623751 (-) 498 WP_001789864.1 competence type IV pilus minor pilin ComGF Machinery gene
  MW_RS07985 (MW1492) comGE 1623669..1624013 (-) 345 WP_000844411.1 hypothetical protein Machinery gene
  MW_RS07990 (MW1493) comGD 1624000..1624446 (-) 447 WP_001788899.1 competence type IV pilus minor pilin ComGD Machinery gene
  MW_RS07995 (MW1494) comGC 1624424..1624735 (-) 312 WP_000472256.1 competence type IV pilus major pilin ComGC Machinery gene
  MW_RS08000 (MW1495) comGB 1624749..1625819 (-) 1071 WP_000776422.1 competence type IV pilus assembly protein ComGB Machinery gene
  MW_RS08005 (MW1496) comGA 1625791..1626765 (-) 975 WP_000697220.1 competence type IV pilus ATPase ComGA Machinery gene
  MW_RS08010 (MW1497) - 1626817..1627440 (-) 624 WP_001223010.1 MBL fold metallo-hydrolase -
  MW_RS08015 (MW1498) - 1627437..1627766 (-) 330 WP_001018871.1 MTH1187 family thiamine-binding protein -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  sigH comGF positive effect
  sigH comGD positive effect
  comK/comK1 comGD positive effect
  sigH dprA positive effect
  comK/comK1 dprA positive effect
  sigH comGA positive effect
  comK/comK1 comGA positive effect
  sigH ssb positive effect
  comK/comK1 ssb positive effect
  comK/comK1 comGF positive effect
  sigH comEC positive effect
  comK/comK1 comEC positive effect
  sigH comGB positive effect
  comK/comK1 comGB positive effect
  sigH comEA positive effect
  comK/comK1 comEA positive effect
  sigH comGC positive effect
  comK/comK1 comGC positive effect
  sigH coiA positive effect
  comK/comK1 coiA positive effect
  sigH comGE positive effect
  comK/comK1 comGE positive effect

Sequence


Protein


Download         Length: 165 a.a.        Molecular weight: 19164.88 Da        Isoelectric Point: 10.2192

>NTDB_id=35 MW_RS07980 WP_001789864.1 1623254..1623751(-) (comGF) [Staphylococcus aureus MW2]
MILSKVTNKFVLFQKIPLLIKRHVYSINVKAFSLIEMLVAMMVISITLLIVPDLIRLSKTFLIESRDLTTVDFEFFSRDI
LDDFKGVDRNDIEIRQHRIILHKGEEMIEYKLINNKIIKVVNDRGNITMINNVTAFTANIYYKSIIKITITVKVGTNVQT
KTIYV

Nucleotide


Download         Length: 498 bp        

>NTDB_id=35 MW_RS07980 WP_001789864.1 1623254..1623751(-) (comGF) [Staphylococcus aureus MW2]
ATGATATTAAGCAAAGTGACCAACAAATTTGTGCTATTTCAAAAAATACCACTTCTTATCAAAAGACATGTATACAGTAT
TAATGTCAAAGCTTTTTCGCTCATTGAAATGTTAGTAGCGATGATGGTTATAAGTATAACTTTACTAATTGTTCCAGACT
TAATTAGACTTAGTAAAACTTTTCTAATTGAAAGTAGGGATTTAACAACTGTAGATTTCGAATTTTTCTCAAGAGATATT
CTAGATGATTTTAAAGGAGTAGATAGAAACGATATTGAAATTAGGCAACACCGTATCATTTTACATAAAGGTGAAGAAAT
GATCGAATACAAATTAATTAATAATAAAATTATTAAAGTTGTAAATGACAGAGGAAATATAACAATGATTAATAATGTTA
CAGCATTTACTGCAAATATCTACTATAAATCCATTATTAAAATAACGATAACAGTTAAAGTCGGTACAAATGTGCAGACT
AAAACTATTTATGTATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2XJ03

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Staphylococcus aureus N315

96.364

100

0.964


Multiple sequence alignment    



References


[1] Annette Fagerlund et al. (2014) Staphylococcus aureus competence genes: mapping of the SigH, ComK1 and ComK2 regulons by transcriptome sequencing. Molecular Microbiology 94(3):557-79. [PMID: 25155269]