Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | MW_RS07995 | Genome accession | NC_003923 |
| Coordinates | 1624424..1624735 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus MW2 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus DNA binding and uptake |
||
Genomic Context
Location: 1619424..1629735
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MW_RS07960 (MW1488) | gcvPA | 1619881..1621227 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| MW_RS07965 (MW1489) | gcvT | 1621247..1622338 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| MW_RS07970 (MW1490) | - | 1622497..1623021 (-) | 525 | WP_001015121.1 | shikimate kinase | - |
| MW_RS07975 | - | 1623011..1623157 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| MW_RS07980 | comGF | 1623254..1623751 (-) | 498 | WP_001789864.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| MW_RS07985 (MW1492) | comGE | 1623669..1624013 (-) | 345 | WP_000844411.1 | hypothetical protein | Machinery gene |
| MW_RS07990 (MW1493) | comGD | 1624000..1624446 (-) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| MW_RS07995 (MW1494) | comGC | 1624424..1624735 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| MW_RS08000 (MW1495) | comGB | 1624749..1625819 (-) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| MW_RS08005 (MW1496) | comGA | 1625791..1626765 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| MW_RS08010 (MW1497) | - | 1626817..1627440 (-) | 624 | WP_001223010.1 | MBL fold metallo-hydrolase | - |
| MW_RS08015 (MW1498) | - | 1627437..1627766 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| MW_RS08020 (MW1499) | - | 1627766..1628752 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| MW_RS08025 (MW1500) | - | 1628749..1628952 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Regulatory network
Positive effect
Negative effect
| Regulator | Target | Regulation |
|---|---|---|
| sigH | comGC | positive effect |
| sigH | comGD | positive effect |
| comK/comK1 | comGD | positive effect |
| sigH | dprA | positive effect |
| comK/comK1 | dprA | positive effect |
| sigH | comGA | positive effect |
| comK/comK1 | comGA | positive effect |
| sigH | ssb | positive effect |
| comK/comK1 | ssb | positive effect |
| sigH | comGF | positive effect |
| comK/comK1 | comGF | positive effect |
| sigH | comEC | positive effect |
| comK/comK1 | comEC | positive effect |
| sigH | comGB | positive effect |
| comK/comK1 | comGB | positive effect |
| sigH | comEA | positive effect |
| comK/comK1 | comEA | positive effect |
| comK/comK1 | comGC | positive effect |
| sigH | coiA | positive effect |
| comK/comK1 | coiA | positive effect |
| sigH | comGE | positive effect |
| comK/comK1 | comGE | positive effect |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=32 MW_RS07995 WP_000472256.1 1624424..1624735(-) (comGC) [Staphylococcus aureus MW2]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=32 MW_RS07995 WP_000472256.1 1624424..1624735(-) (comGC) [Staphylococcus aureus MW2]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus suis isolate S10 |
50 |
83.871 |
0.419 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.304 |
93.878 |
0.388 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |
Multiple sequence alignment
References
| [1] | Annette Fagerlund et al. (2014) Staphylococcus aureus competence genes: mapping of the SigH, ComK1 and ComK2 regulons by transcriptome sequencing. Molecular Microbiology 94(3):557-79. [PMID: 25155269] |