Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | SGO_RS09410 | Genome accession | NC_009785 |
| Coordinates | 1990432..1990749 (-) | Length | 105 a.a. |
| NCBI ID | WP_012130940.1 | Uniprot ID | O06668 |
| Organism | Streptococcus gordonii str. Challis substr. CH1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus DNA binding and uptake |
||
Function
comYA appeared to be part of a putative operon encompassing a comGB homolog, designated comYB, together with sequences that could encode ComGC- and ComGD-like peptides designated ComYC and ComYD, respectively, as well as other components. Northern analysis identified a single 6.0-kb comYA-containing transcript strictly dependent on exogenous competence factor for expression in ComA1 cells. An identical pattern of expression was seen in wild-type Challis cells grown under conditions of maximal competence but not in cells that were noncompetent.
Genomic Context
Location: 1985432..1995749
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SGO_RS09375 (SGO_1915) | - | 1986009..1986674 (-) | 666 | WP_012130933.1 | CPBP family intramembrane glutamic endopeptidase | - |
| SGO_RS09380 (SGO_1916) | - | 1986722..1987912 (-) | 1191 | WP_012130934.1 | acetate kinase | - |
| SGO_RS09385 (SGO_1917) | comGH | 1987962..1988915 (-) | 954 | WP_012130935.1 | class I SAM-dependent methyltransferase | Machinery gene |
| SGO_RS09390 (SGO_1918) | comGG | 1988946..1989377 (-) | 432 | WP_223341947.1 | competence type IV pilus minor pilin ComGG | - |
| SGO_RS09395 (SGO_1919) | comGF/cglF | 1989358..1989795 (-) | 438 | WP_012130937.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SGO_RS09400 (SGO_1920) | comGE/cglE | 1989779..1990072 (-) | 294 | WP_012130938.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| SGO_RS09405 (SGO_1921) | comGD | 1990044..1990472 (-) | 429 | WP_012130939.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SGO_RS09410 (SGO_1922) | comGC | 1990432..1990749 (-) | 318 | WP_012130940.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SGO_RS09415 (SGO_1923) | comGB | 1990746..1991780 (-) | 1035 | WP_012130941.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SGO_RS09420 (SGO_1924) | comGA | 1991692..1992651 (-) | 960 | WP_012130942.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SGO_RS09425 (SGO_1925) | - | 1992753..1993121 (-) | 369 | WP_012130943.1 | DUF1033 family protein | - |
Sequence
Protein
Download Length: 105 a.a. Molecular weight: 11461.38 Da Isoelectric Point: 9.9223
MNKLKKLRVKAFTLVEMLVVLLIISVLMLLFVPNLTKQKEAVSDTGNAAVVKVVESQAELYELKNTGDQATLSKLVAAGN
ISQKQADSYKAYYGKNNSETQAVAN
Nucleotide
Download Length: 318 bp
ATGAACAAATTAAAAAAATTACGTGTGAAAGCTTTTACTTTAGTGGAAATGCTAGTTGTCCTTCTGATCATCAGTGTCCT
TATGCTCTTATTTGTCCCTAATTTAACCAAGCAAAAAGAGGCAGTTTCGGATACTGGAAATGCTGCGGTGGTTAAGGTAG
TTGAGAGCCAGGCTGAGCTCTATGAACTCAAAAATACAGGAGATCAAGCAACCCTCAGCAAATTAGTCGCAGCTGGGAAC
ATTAGTCAAAAGCAAGCAGACTCTTACAAGGCTTATTATGGTAAGAACAATAGTGAGACTCAGGCAGTTGCCAATTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Streptococcus mutans UA159 |
71.429 |
100 |
0.721 |
| comGC | Streptococcus mutans UA140 |
71.429 |
100 |
0.721 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
69.524 |
100 |
0.695 |
| comGC/cglC | Streptococcus mitis SK321 |
68.932 |
98.095 |
0.676 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
67.961 |
98.095 |
0.667 |
| comGC/cglC | Streptococcus pneumoniae R6 |
67.961 |
98.095 |
0.667 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
67.961 |
98.095 |
0.667 |
| comGC/cglC | Streptococcus pneumoniae D39 |
67.961 |
98.095 |
0.667 |
| comGC | Streptococcus suis isolate S10 |
61.798 |
95.699 |
0.591 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
59.794 |
92.381 |
0.552 |
| comGC | Staphylococcus aureus MW2 |
42.857 |
95.146 |
0.408 |
| comGC | Staphylococcus aureus N315 |
42.857 |
95.146 |
0.408 |
Multiple sequence alignment
References
| [1] | R D Lunsford et al. (1997) comYA, a gene similar to comGA of Bacillus subtilis, is essential for competence-factor-dependent DNA transformation in Streptococcus gordonii. Journal of Bacteriology 179(10):3122-6. [PMID: 9150204] |