Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | KW2_RS10845 | Genome accession | NC_022369 |
| Coordinates | 2243548..2243898 (-) | Length | 116 a.a. |
| NCBI ID | WP_051303741.1 | Uniprot ID | - |
| Organism | Lactococcus lactis subsp. cremoris KW2 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus DNA binding and uptake |
||
Genomic Context
Location: 2238548..2248898
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KW2_RS10805 (kw2_2175) | - | 2239082..2239891 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| KW2_RS10810 (kw2_2176) | - | 2239884..2240621 (-) | 738 | WP_011836039.1 | metal ABC transporter ATP-binding protein | - |
| KW2_RS10815 (kw2_2177) | - | 2240800..2241642 (-) | 843 | WP_011677179.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| KW2_RS10820 (kw2_2178) | - | 2241639..2242076 (-) | 438 | WP_011836041.1 | zinc-dependent MarR family transcriptional regulator | - |
| KW2_RS10825 (kw2_2179) | comGG | 2242157..2242456 (-) | 300 | WP_021037947.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| KW2_RS10830 (kw2_2180) | comGF | 2242480..2242905 (-) | 426 | WP_014735174.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| KW2_RS10835 (kw2_2181) | comGE | 2242889..2243185 (-) | 297 | WP_014735175.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| KW2_RS10840 (kw2_2182) | comGD | 2243157..2243600 (-) | 444 | WP_096816401.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| KW2_RS10845 (kw2_2183) | comGC | 2243548..2243898 (-) | 351 | WP_051303741.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| KW2_RS10850 (kw2_2184) | comGB | 2243943..2244968 (-) | 1026 | WP_042211510.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| KW2_RS10855 (kw2_2185) | comGA | 2244868..2245848 (-) | 981 | WP_011836048.1 | competence type IV pilus ATPase ComGA | Machinery gene |
Regulatory network
Positive effect
Negative effect
| Regulator | Target | Regulation |
|---|---|---|
| comX | comGC | positive effect |
| comX | comGG | positive effect |
| comX | comEA | positive effect |
| comX | ssbB | positive effect |
| comX | comGD | positive effect |
| comX | dprA | positive effect |
| comX | comFA | positive effect |
| comX | coiA | positive effect |
| comX | comGB | positive effect |
| comX | recA | positive effect |
| comX | comFC | positive effect |
| comX | comGE | positive effect |
| comX | comGF | positive effect |
| comX | comEC | positive effect |
| comX | comGA | positive effect |
| mecA | comX | negative effect |
| clpC | comX | negative effect |
| clpP | comX | negative effect |
Sequence
Protein
Download Length: 116 a.a. Molecular weight: 13192.34 Da Isoelectric Point: 7.1636
>NTDB_id=588 KW2_RS10845 WP_051303741.1 2243548..2243898(-) (comGC) [Lactococcus lactis subsp. cremoris KW2]
MSKALSLVKIHGRKLCQKKQKAFTLIEMLIVLAIISILILLFVPNLIKEKAQVQKTGEAAVVKVVESQAQLYELDHDNDK
PNLSELLSAGMITQKQVTAYDDYYDQNKNEQRNFDD
MSKALSLVKIHGRKLCQKKQKAFTLIEMLIVLAIISILILLFVPNLIKEKAQVQKTGEAAVVKVVESQAQLYELDHDNDK
PNLSELLSAGMITQKQVTAYDDYYDQNKNEQRNFDD
Nucleotide
Download Length: 351 bp
>NTDB_id=588 KW2_RS10845 WP_051303741.1 2243548..2243898(-) (comGC) [Lactococcus lactis subsp. cremoris KW2]
ATGAGCAAAGCTTTGTCATTAGTTAAAATTCACGGAAGAAAGCTTTGTCAAAAAAAGCAAAAAGCATTTACCTTGATTGA
GATGTTAATTGTGTTGGCAATTATCAGTATTTTAATTTTGCTTTTTGTGCCAAATTTGATAAAAGAAAAAGCACAAGTTC
AAAAAACTGGTGAAGCAGCAGTAGTTAAAGTAGTTGAAAGTCAGGCACAACTTTATGAGTTGGATCATGATAATGATAAG
CCAAACCTATCAGAACTTTTAAGTGCGGGGATGATTACGCAAAAGCAAGTCACGGCCTATGATGATTACTATGACCAGAA
TAAAAATGAACAGCGCAATTTCGATGATTAG
ATGAGCAAAGCTTTGTCATTAGTTAAAATTCACGGAAGAAAGCTTTGTCAAAAAAAGCAAAAAGCATTTACCTTGATTGA
GATGTTAATTGTGTTGGCAATTATCAGTATTTTAATTTTGCTTTTTGTGCCAAATTTGATAAAAGAAAAAGCACAAGTTC
AAAAAACTGGTGAAGCAGCAGTAGTTAAAGTAGTTGAAAGTCAGGCACAACTTTATGAGTTGGATCATGATAATGATAAG
CCAAACCTATCAGAACTTTTAAGTGCGGGGATGATTACGCAAAAGCAAGTCACGGCCTATGATGATTACTATGACCAGAA
TAAAAATGAACAGCGCAATTTCGATGATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
59.794 |
92.381 |
0.552 |
| comGC | Streptococcus mutans UA159 |
55.446 |
97.115 |
0.538 |
| comGC | Streptococcus mutans UA140 |
55.446 |
97.115 |
0.538 |
| comGC | Streptococcus suis isolate S10 |
56.818 |
94.624 |
0.538 |
| comGC/cglC | Streptococcus mitis SK321 |
55.882 |
94.444 |
0.528 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
54.455 |
94.393 |
0.514 |
| comGC/cglC | Streptococcus pneumoniae D39 |
53.922 |
94.444 |
0.509 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
53.922 |
94.444 |
0.509 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
53.922 |
94.444 |
0.509 |
| comGC/cglC | Streptococcus pneumoniae R6 |
53.922 |
94.444 |
0.509 |
| comGC | Staphylococcus aureus N315 |
46.341 |
79.612 |
0.369 |
| comGC | Staphylococcus aureus MW2 |
46.341 |
79.612 |
0.369 |
Multiple sequence alignment
References
| [1] | Blandine David et al. (2017) Natural DNA Transformation Is Functional in Lactococcus lactis subsp. cremoris KW2. Applied And Environmental Microbiology 83(16):e01074-17. [PMID: 28625996] |