Detailed information NTG0000460

Experimentally validated

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: GPW51_RS00790
• Genome accession: NZ_LR738721
• Coordinates: 121823..122104 (+)
• Length: 93 a.a.
• NCBI ID: WP_011921720.1
• Uniprot ID: A0A0M9FL05
• Organism: Streptococcus suis isolate S10
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus DNA binding and uptake

Function

Mutants lacking the major pilin gene comYC were not transformable demonstrating that the DNA uptake pilus is indeed required for competence development in S. suis.

Genomic Context

Location: 116823..127104

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GPW51_RS00770	-	118490..118855 (+)	366	WP_002936568.1	DUF1033 family protein	-
GPW51_RS00775	-	118890..119836 (-)	947	Protein_114	S66 family peptidase	-
GPW51_RS00780	comYA	119922..120872 (+)	951	WP_011921718.1	competence type IV pilus ATPase ComGA	Machinery gene
GPW51_RS00785	comYB	120784..121821 (+)	1038	WP_011921719.1	competence type IV pilus assembly protein ComGB	Machinery gene
GPW51_RS00790	comYC	121823..122104 (+)	282	WP_011921720.1	competence type IV pilus major pilin ComGC	Machinery gene
GPW51_RS00795	comGD	122085..122492 (+)	408	WP_011921721.1	competence type IV pilus minor pilin ComGD	-
GPW51_RS00800	comYE	122464..122757 (+)	294	WP_011921722.1	competence type IV pilus minor pilin ComGE	Machinery gene
GPW51_RS00805	comGF/cglF	122744..123178 (+)	435	WP_011922561.1	competence type IV pilus minor pilin ComGF	Machinery gene
GPW51_RS00810	comGG	123156..123566 (+)	411	WP_011921724.1	competence type IV pilus minor pilin ComGG	-
GPW51_RS00815	comYH	123623..124576 (+)	954	WP_011922562.1	class I SAM-dependent methyltransferase	Machinery gene
GPW51_RS00820	-	124626..125813 (+)	1188	WP_012775422.1	acetate kinase	-
GPW51_RS00825	-	126128..126679 (+)	552	WP_012774908.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10408.34 Da
• Isoelectric Point: 7.0117

>NTDB_id=460 GPW51_RS00790 WP_011921720.1 121823..122104(+) (comYC) [Streptococcus suis isolate S10]
MKKLVEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSQQKDAIQKKGDAAVVKVVESQMELYELEHDEEATVADLQAKGYI
TEKQAKQYATAKK

Nucleotide

• Length: 282 bp

>NTDB_id=460 GPW51_RS00790 WP_011921720.1 121823..122104(+) (comYC) [Streptococcus suis isolate S10]
ATGAAAAAATTAGTTGAAATGAAGGTAAAAGGGTTCACTCTGGTGGAAATGTTGGTCGTTTTAGGGATCATTAGCCTGCT
CTTGCTCCTCTTTGTGCCAAATTTGAGCCAGCAGAAGGATGCTATTCAGAAGAAGGGGGATGCGGCTGTTGTCAAAGTAG
TGGAGAGTCAGATGGAGCTCTATGAATTGGAACATGACGAGGAAGCAACGGTGGCAGATTTGCAGGCGAAAGGTTATATT
ACTGAAAAACAAGCAAAACAGTATGCTACGGCGAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: A0A0M9FL05

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus mitis SK321	68.235	91.398	0.624
comGC/cglC	Streptococcus mitis NCTC 12261	68.235	91.398	0.624
comGC/cglC	Streptococcus pneumoniae Rx1	70.37	87.097	0.613
comGC/cglC	Streptococcus pneumoniae R6	70.37	87.097	0.613
comGC/cglC	Streptococcus pneumoniae D39	70.37	87.097	0.613
comGC/cglC	Streptococcus pneumoniae TIGR4	70.37	87.097	0.613
comYC	Streptococcus gordonii str. Challis substr. CH1	61.798	95.699	0.591
comYC	Streptococcus mutans UA140	60.227	94.624	0.57
comYC	Streptococcus mutans UA159	60.227	94.624	0.57
comGC	Lactococcus lactis subsp. cremoris KW2	56.818	94.624	0.538
comGC	Staphylococcus aureus MW2	50	83.871	0.419
comGC	Staphylococcus aureus N315	50	83.871	0.419
comGC	Bacillus subtilis subsp. subtilis str. 168	49.333	80.645	0.398
comGC	Latilactobacillus sakei subsp. sakei 23K	43.75	86.022	0.376

References

• [1]: Edoardo Zaccaria et al. (2014) Control of competence for DNA transformation in streptococcus suis by genetically transferable pherotypes. PloS One 9(6):e99394. [PMID: 24968201]