Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | LCA_RS06470 | Genome accession | NC_007576 |
| Coordinates | 1278747..1279046 (-) | Length | 99 a.a. |
| NCBI ID | WP_011374999.1 | Uniprot ID | Q38W25 |
| Organism | Latilactobacillus sakei subsp. sakei 23K | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus DNA binding and uptake |
||
Genomic Context
Location: 1273747..1284046
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LCA_RS06435 | - | 1274378..1274836 (-) | 459 | WP_011374992.1 | hypothetical protein | - |
| LCA_RS06440 (LCA_1298) | - | 1274891..1276087 (-) | 1197 | WP_011374993.1 | acetate/propionate family kinase | - |
| LCA_RS06445 (LCA_1299) | - | 1276109..1277119 (-) | 1011 | WP_011374994.1 | class I SAM-dependent methyltransferase | - |
| LCA_RS06450 (LCA_1300) | - | 1277243..1277581 (-) | 339 | WP_011374995.1 | hypothetical protein | - |
| LCA_RS06455 (LCA_1301) | comGF | 1277544..1278056 (-) | 513 | WP_041820873.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LCA_RS06460 (LCA_1302) | comGE | 1278031..1278336 (-) | 306 | WP_011374997.1 | hypothetical protein | Machinery gene |
| LCA_RS06465 (LCA_1303) | comGD | 1278323..1278775 (-) | 453 | WP_041820876.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LCA_RS06470 (LCA_1304) | comGC | 1278747..1279046 (-) | 300 | WP_011374999.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | Machinery gene |
| LCA_RS06475 (LCA_1305) | comGB | 1279043..1280050 (-) | 1008 | WP_011375000.1 | type II secretion system F family protein | Machinery gene |
| LCA_RS06480 (LCA_1306) | comGA | 1280043..1280933 (-) | 891 | WP_011375001.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| LCA_RS06485 (LCA_1307) | - | 1281049..1281780 (-) | 732 | WP_011375002.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
| LCA_RS06490 (LCA_1308) | - | 1281871..1282371 (-) | 501 | WP_011375003.1 | VanZ family protein | - |
| LCA_RS06495 (LCA_1309) | - | 1282468..1282842 (+) | 375 | WP_011375004.1 | hypothetical protein | - |
Regulatory network
Positive effect
Negative effect
| Regulator | Target | Regulation |
|---|---|---|
| sigH | comGC | positive effect |
| sigH | comEC | positive effect |
| sigH | comFC | positive effect |
| sigH | comGE | positive effect |
| sigH | recA | positive effect |
| sigH | comGA | positive effect |
| sigH | ssb | positive effect |
| sigH | comEA | positive effect |
| sigH | comFA | positive effect |
| sigH | comGB | positive effect |
| sigH | dprA | positive effect |
| sigH | comGD | positive effect |
| sigH | comGF | positive effect |
| sigH | comC | positive effect |
Sequence
Protein
Download Length: 99 a.a. Molecular weight: 10994.02 Da Isoelectric Point: 10.2663
>NTDB_id=619 LCA_RS06470 WP_011374999.1 1278747..1279046(-) (comGC) [Latilactobacillus sakei subsp. sakei 23K]
MKKKRKAFTLIEMVVVLAIIALLILLVAPNLGAQKQRAEKKTDQALVTTLQTQVELASDEIGHQIKSLDELTDKYISKDQ
LKHAKEKGITIEGGTVKQK
MKKKRKAFTLIEMVVVLAIIALLILLVAPNLGAQKQRAEKKTDQALVTTLQTQVELASDEIGHQIKSLDELTDKYISKDQ
LKHAKEKGITIEGGTVKQK
Nucleotide
Download Length: 300 bp
>NTDB_id=619 LCA_RS06470 WP_011374999.1 1278747..1279046(-) (comGC) [Latilactobacillus sakei subsp. sakei 23K]
ATGAAGAAAAAAAGAAAAGCTTTTACACTAATTGAAATGGTAGTTGTTCTTGCCATTATTGCGTTACTAATCTTATTAGT
TGCACCAAACCTAGGTGCTCAAAAACAGCGCGCGGAGAAGAAAACGGATCAAGCTTTGGTGACGACTTTGCAAACGCAAG
TTGAATTAGCTAGCGACGAGATTGGTCATCAAATTAAGAGTCTAGACGAATTAACGGATAAGTATATTTCAAAAGACCAA
TTAAAGCACGCAAAGGAGAAGGGGATTACAATTGAAGGCGGCACGGTTAAGCAAAAATGA
ATGAAGAAAAAAAGAAAAGCTTTTACACTAATTGAAATGGTAGTTGTTCTTGCCATTATTGCGTTACTAATCTTATTAGT
TGCACCAAACCTAGGTGCTCAAAAACAGCGCGCGGAGAAGAAAACGGATCAAGCTTTGGTGACGACTTTGCAAACGCAAG
TTGAATTAGCTAGCGACGAGATTGGTCATCAAATTAAGAGTCTAGACGAATTAACGGATAAGTATATTTCAAAAGACCAA
TTAAAGCACGCAAAGGAGAAGGGGATTACAATTGAAGGCGGCACGGTTAAGCAAAAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
45.349 |
86.869 |
0.394 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
45.349 |
86.869 |
0.394 |
| comGC/cglC | Streptococcus pneumoniae D39 |
45.349 |
86.869 |
0.394 |
| comGC/cglC | Streptococcus pneumoniae R6 |
45.349 |
86.869 |
0.394 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
44.186 |
86.869 |
0.384 |
| comGC | Streptococcus suis isolate S10 |
43.75 |
86.022 |
0.376 |
Multiple sequence alignment
References
| [1] | Solveig Schmid et al. (2012) Alternative sigma factor σH activates competence gene expression in Lactobacillus sakei. BMC Microbiology 12:32. [PMID: 22409597] |