Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | SPR_RS09420 | Genome accession | NC_003098 |
| Coordinates | 1833266..1833592 (-) | Length | 108 a.a. |
| NCBI ID | WP_000738626.1 | Uniprot ID | Q8DN88 |
| Organism | Streptococcus pneumoniae R6 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus DNA binding and uptake |
||
Genomic Context
Location: 1828266..1838592
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPR_RS09380 (spr1853) | rnpA | 1828283..1828654 (-) | 372 | WP_000739246.1 | ribonuclease P protein component | - |
| SPR_RS11020 | - | 1828671..1828802 (-) | 132 | WP_000768904.1 | hypothetical protein | - |
| SPR_RS09385 (spr1854) | - | 1828803..1829993 (-) | 1191 | WP_000167757.1 | acetate kinase | - |
| SPR_RS09390 (spr1855) | comYH | 1830044..1830997 (-) | 954 | WP_000345135.1 | class I SAM-dependent methyltransferase | Machinery gene |
| SPR_RS09395 (spr1856) | - | 1831058..1831652 (-) | 595 | Protein_1829 | class I SAM-dependent methyltransferase | - |
| SPR_RS09400 (spr1858) | comGG/cglG | 1831789..1832202 (-) | 414 | WP_000265622.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| SPR_RS09405 (spr1859) | comGF/cglF | 1832180..1832641 (-) | 462 | WP_000250534.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SPR_RS09410 | comGE/cglE | 1832604..1832906 (-) | 303 | WP_000413382.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| SPR_RS09415 (spr1861) | comGD/cglD | 1832869..1833273 (-) | 405 | WP_000588026.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SPR_RS09420 (spr1862) | comGC/cglC | 1833266..1833592 (-) | 327 | WP_000738626.1 | comG operon protein ComGC | Machinery gene |
| SPR_RS09425 (spr1863) | comGB/cglB | 1833594..1834610 (-) | 1017 | WP_074196785.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SPR_RS09430 (spr1864) | comGA/cglA/cilD | 1834558..1835499 (-) | 942 | WP_000249564.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SPR_RS09435 (spr1865) | - | 1835575..1835940 (-) | 366 | WP_000286415.1 | DUF1033 family protein | - |
| SPR_RS09440 (spr1866) | - | 1836091..1837149 (-) | 1059 | WP_000649468.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| SPR_RS09445 (spr1867) | nagA | 1837312..1838463 (-) | 1152 | WP_001134457.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
Sequence
Protein
Download Length: 108 a.a. Molecular weight: 12200.38 Da Isoelectric Point: 10.1877
>NTDB_id=197 SPR_RS09420 WP_000738626.1 1833266..1833592(-) (comGC/cglC) [Streptococcus pneumoniae R6]
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLRKLQA
DGRITEEQAKAYKEYHDKNGGANRKVND
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLRKLQA
DGRITEEQAKAYKEYHDKNGGANRKVND
Nucleotide
Download Length: 327 bp
>NTDB_id=197 SPR_RS09420 WP_000738626.1 1833266..1833592(-) (comGC/cglC) [Streptococcus pneumoniae R6]
ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAGATGTTGGTGGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTAGAAAAGAATGAAGATGCTAGCCTAAGAAAGTTACAAGCA
GATGGACGCATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACCATGATAAAAATGGAGGAGCAAATCGTAAAGTCAA
TGATTAA
ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAGATGTTGGTGGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTAGAAAAGAATGAAGATGCTAGCCTAAGAAAGTTACAAGCA
GATGGACGCATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACCATGATAAAAATGGAGGAGCAAATCGTAAAGTCAA
TGATTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
99.074 |
100 |
0.991 |
| comGC/cglC | Streptococcus mitis SK321 |
94.444 |
100 |
0.944 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
92.157 |
95.327 |
0.879 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
67.961 |
98.095 |
0.667 |
| comYC | Streptococcus suis isolate S10 |
70.37 |
87.097 |
0.613 |
| comYC | Streptococcus mutans UA140 |
63.636 |
95.192 |
0.606 |
| comYC | Streptococcus mutans UA159 |
63.636 |
95.192 |
0.606 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
53.922 |
94.444 |
0.509 |
| comGC | Staphylococcus aureus MW2 |
46.078 |
99.029 |
0.456 |
| comGC | Staphylococcus aureus N315 |
46.078 |
99.029 |
0.456 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
45.349 |
86.869 |
0.394 |
Multiple sequence alignment
References
| [1] | Trinh Lam et al. (2021) Competence pili in Streptococcus pneumoniae are highly dynamic structures that retract to promote DNA uptake. Molecular Microbiology 116(2):381-396. [PMID: 33754381] |
| [2] | Vitor Oliveira et al. (2021) The Role of Minor Pilins in Assembly and Function of the Competence Pilus of Streptococcus pneumoniae. Frontiers in Cellular And Infection Microbiology 11:808601. [PMID: 35004361] |
| [3] | Devon Sheppard et al. (2020) The major subunit of widespread competence pili exhibits a novel and conserved type IV pilin fold. The Journal of Biological Chemistry 295(19):6594-6604. [PMID: 32273343] |
| [4] | Sandra Muschiol et al. (2017) Structure of the competence pilus major pilin ComGC in Streptococcus pneumoniae. The Journal of Biological Chemistry 292(34):14134-14146. [PMID: 28659339] |
| [5] | Sandra Muschiol et al. (2015) Uptake of extracellular DNA: competence induced pili in natural transformation of Streptococcus pneumoniae. BioEssays : News And Reviews in Molecular, Cellular And Developmental Biology 37(4):426-35. [PMID: 25640084] |
| [6] | Raphaël Laurenceau et al. (2013) A type IV pilus mediates DNA binding during natural transformation in Streptococcus pneumoniae. PLoS Pathogens 9(6):e1003473. [PMID: 23825953] |
| [7] | Scott N Peterson et al. (2004) Identification of competence pheromone responsive genes in Streptococcus pneumoniae by use of DNA microarrays. Molecular Microbiology 51(4):1051-70. [PMID: 14763980] |