Detailed information NTG0000594

Experimentally validated

Overview

• Name: comFC
• Type: Machinery gene
• Locus tag: KW2_RS12255
• Genome accession: NC_022369
• Coordinates: 1056796..1057200 (-)
• Length: 134 a.a.
• NCBI ID: WP_244878749.1
• Uniprot ID: -
• Organism: Lactococcus lactis subsp. cremoris KW2
• Function: ssDNA transport into the cell DNA binding and uptake

Function

ComX induce the expression of late competence genes.

Genomic Context

Location: 1051796..1062200

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
KW2_RS05095 (kw2_1027)	-	1051853..1053385 (+)	1533	WP_021037142.1	Nramp family divalent metal transporter	-
KW2_RS05100 (kw2_1028)	-	1053459..1054427 (+)	969	WP_021037143.1	PhoH family protein	-
KW2_RS05105 (kw2_1029)	-	1054497..1054985 (+)	489	WP_021037144.1	NUDIX hydrolase	-
KW2_RS05110 (kw2_1030)	ybeY	1055215..1055703 (+)	489	WP_011835335.1	rRNA maturation RNase YbeY	-
KW2_RS05115 (kw2_1031)	-	1055687..1056142 (+)	456	WP_011676094.1	diacylglycerol kinase family protein	-
KW2_RS05120 (kw2_1032)	-	1056159..1056737 (+)	579	WP_021037145.1	nucleotidyltransferase family protein	-
KW2_RS12255	comFC	1056796..1057200 (-)	405	WP_244878749.1	ComF family protein	Machinery gene
KW2_RS05130 (kw2_1034)	comFA	1057446..1058738 (-)	1293	WP_021037147.1	DEAD/DEAH box helicase	Machinery gene
KW2_RS05135 (kw2_1035)	-	1058795..1059430 (+)	636	WP_011835331.1	YigZ family protein	-
KW2_RS05140 (kw2_1036)	-	1059472..1059972 (+)	501	WP_021037148.1	VanZ family protein	-
KW2_RS05145 (kw2_1037)	-	1060038..1061057 (+)	1020	WP_021037149.1	DUF475 domain-containing protein	-
KW2_RS05150 (kw2_1038)	-	1061167..1061934 (+)	768	WP_021037150.1	hypothetical protein	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
comX	comFC	positive effect
comX	comGG	positive effect
comX	comEA	positive effect
comX	ssbB	positive effect
comX	comGD	positive effect
comX	dprA	positive effect
comX	comFA	positive effect
comX	coiA	positive effect
comX	comGB	positive effect
comX	recA	positive effect
comX	comGE	positive effect
comX	comGF	positive effect
comX	comEC	positive effect
comX	comGA	positive effect
comX	comGC	positive effect
mecA	comX	negative effect
clpC	comX	negative effect
clpP	comX	negative effect

Sequence

Protein

• Length: 134 a.a.
• Molecular weight: 15746.28 Da
• Isoelectric Point: 9.9825

>NTDB_id=594 KW2_RS12255 WP_244878749.1 1056796..1057200(-) (comFC) [Lactococcus lactis subsp. cremoris KW2]
MKDYFSLYKFMGDYRLHEVFDSYFKNLSKKIPLVPIPVSPKRLQERGFNQVTAFLKDRTYLDLLEKEDTVRQSSLNREGR
LSTTNPFKLKEGEKIPQKIILIDDIYTTGTTFYHAIKTLKKANPIEITTFSLCR

Nucleotide

• Length: 405 bp

>NTDB_id=594 KW2_RS12255 WP_244878749.1 1056796..1057200(-) (comFC) [Lactococcus lactis subsp. cremoris KW2]
ATGAAGGATTACTTTAGTCTTTACAAATTTATGGGAGATTATCGATTACACGAAGTCTTCGATTCCTATTTTAAAAATTT
GTCCAAAAAAATTCCTCTGGTTCCCATTCCGGTTTCTCCTAAAAGATTACAAGAAAGAGGGTTTAACCAAGTAACAGCTT
TTCTAAAAGATAGAACTTATCTTGATTTGCTTGAAAAAGAGGATACTGTCAGACAATCAAGTCTTAATCGCGAGGGACGT
TTATCAACTACCAATCCTTTTAAGTTGAAAGAGGGTGAAAAAATACCCCAAAAAATCATTTTGATTGATGATATTTATAC
AACTGGAACTACTTTTTATCATGCAATAAAAACCTTAAAGAAAGCTAATCCGATTGAAATTACAACTTTCTCACTCTGCC
GTTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comFC/cflB	Streptococcus mitis NCTC 12261	50.36	100	0.522
comFC/cflB	Streptococcus pneumoniae D39	48.921	100	0.507
comFC/cflB	Streptococcus pneumoniae Rx1	48.921	100	0.507
comFC/cflB	Streptococcus pneumoniae TIGR4	48.921	100	0.507
comFC/cflB	Streptococcus pneumoniae R6	48.921	100	0.507
comFC/cflB	Streptococcus mitis SK321	48.201	100	0.5
comFC	Latilactobacillus sakei subsp. sakei 23K	37.241	100	0.403
comFC	Bacillus subtilis subsp. subtilis str. 168	37.063	100	0.396

References

• [1]: Blandine David et al. (2017) Natural DNA Transformation Is Functional in Lactococcus lactis subsp. cremoris KW2. Applied And Environmental Microbiology 83(16):e01074-17. [PMID: 28625996]