Detailed information    

experimental Experimentally validated

Overview

Name   comGG   Type   Machinery gene
Locus tag   KW2_RS10825 Genome accession   NC_022369
Coordinates   2242157..2242456 (-) Length   99 a.a.
NCBI ID   WP_021037947.1    Uniprot ID   A0AAX4AJK4
Organism   Lactococcus lactis subsp. cremoris KW2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus   
DNA binding and uptake

Function

The competence sigma factor comX is functional for the activation of the comG operon from strain KW2 when it is constitutively produced.


Genomic Context

Location: 2237157..2247456
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KW2_RS10795 (kw2_2173) - 2237616..2237993 (-) 378 WP_041168662.1 pyridoxamine 5'-phosphate oxidase family protein -
  KW2_RS10800 (kw2_2174) - 2238188..2239060 (+) 873 WP_021037946.1 RluA family pseudouridine synthase -
  KW2_RS10805 (kw2_2175) - 2239082..2239891 (-) 810 WP_011677177.1 metal ABC transporter permease -
  KW2_RS10810 (kw2_2176) - 2239884..2240621 (-) 738 WP_011836039.1 metal ABC transporter ATP-binding protein -
  KW2_RS10815 (kw2_2177) - 2240800..2241642 (-) 843 WP_011677179.1 metal ABC transporter solute-binding protein, Zn/Mn family -
  KW2_RS10820 (kw2_2178) - 2241639..2242076 (-) 438 WP_011836041.1 zinc-dependent MarR family transcriptional regulator -
  KW2_RS10825 (kw2_2179) comGG 2242157..2242456 (-) 300 WP_021037947.1 competence type IV pilus minor pilin ComGG Machinery gene
  KW2_RS10830 (kw2_2180) comGF 2242480..2242905 (-) 426 WP_014735174.1 competence type IV pilus minor pilin ComGF Machinery gene
  KW2_RS10835 (kw2_2181) comGE 2242889..2243185 (-) 297 WP_014735175.1 competence type IV pilus minor pilin ComGE Machinery gene
  KW2_RS10840 (kw2_2182) comGD 2243157..2243600 (-) 444 WP_096816401.1 competence type IV pilus minor pilin ComGD Machinery gene
  KW2_RS10845 (kw2_2183) comGC 2243548..2243898 (-) 351 WP_051303741.1 competence type IV pilus major pilin ComGC Machinery gene
  KW2_RS10850 (kw2_2184) comGB 2243943..2244968 (-) 1026 WP_042211510.1 competence type IV pilus assembly protein ComGB Machinery gene
  KW2_RS10855 (kw2_2185) comGA 2244868..2245848 (-) 981 WP_011836048.1 competence type IV pilus ATPase ComGA Machinery gene

Regulatory network

Positive effect      
Negative effect
Regulator Target Regulation
  comX comGG positive effect
  comX comEA positive effect
  comX ssbB positive effect
  comX comGD positive effect
  comX dprA positive effect
  comX comFA positive effect
  comX coiA positive effect
  comX comGB positive effect
  comX recA positive effect
  comX comFC positive effect
  comX comGE positive effect
  comX comGF positive effect
  comX comEC positive effect
  comX comGA positive effect
  comX comGC positive effect
  mecA comX negative effect
  clpC comX negative effect
  clpP comX negative effect

Sequence

Protein


Download         Length: 99 a.a.        Molecular weight: 11269.27 Da        Isoelectric Point: 9.8236

>NTDB_id=592 KW2_RS10825 WP_021037947.1 2242157..2242456(-) (comGG) [Lactococcus lactis subsp. cremoris KW2]
MVLLLIFSLFLQFYLQKQVLTAQQLKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSN
KTYCFDVRLKDGRIFQIKK

Nucleotide


Download         Length: 300 bp        

>NTDB_id=592 KW2_RS10825 WP_021037947.1 2242157..2242456(-) (comGG) [Lactococcus lactis subsp. cremoris KW2]
TTGGTTTTACTGCTAATTTTTTCTTTATTTCTACAGTTTTATTTGCAAAAACAGGTGCTTACAGCTCAGCAATTGAAAAT
AGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCAACTTAATT
TTGATTGTGGAAATTTAACTTATAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTGTTAGTAAT
AAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTTTCAAATAAAAAAGTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References

[1] Blandine David et al. (2017) Natural DNA Transformation Is Functional in Lactococcus lactis subsp. cremoris KW2. Applied And Environmental Microbiology 83(16):e01074-17. [PMID: 28625996]