Detailed information NTG0000432

Experimentally validated

Overview

• Name: comYD
• Type: Machinery gene
• Locus tag: SGO_RS09405
• Genome accession: NC_009785
• Coordinates: 1990044..1990472 (-)
• Length: 142 a.a.
• NCBI ID: WP_012130939.1
• Uniprot ID: A8AZH7
• Organism: Streptococcus gordonii str. Challis substr. CH1
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus DNA binding and uptake

Function

comYA appeared to be part of a putative operon encompassing a comGB homolog, designated comYB, together with sequences that could encode ComGC- and ComGD-like peptides designated ComYC and ComYD, respectively, as well as other components. Northern analysis identified a single 6.0-kb comYA-containing transcript strictly dependent on exogenous competence factor for expression in ComA1 cells. An identical pattern of expression was seen in wild-type Challis cells grown under conditions of maximal competence but not in cells that were noncompetent.

Genomic Context

Location: 1985044..1995472

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SGO_RS09375 (SGO_1915)	-	1986009..1986674 (-)	666	WP_012130933.1	CPBP family intramembrane glutamic endopeptidase	-
SGO_RS09380 (SGO_1916)	-	1986722..1987912 (-)	1191	WP_012130934.1	acetate kinase	-
SGO_RS09385 (SGO_1917)	comYH	1987962..1988915 (-)	954	WP_012130935.1	class I SAM-dependent methyltransferase	Machinery gene
SGO_RS09390 (SGO_1918)	comGG	1988946..1989377 (-)	432	WP_223341947.1	competence type IV pilus minor pilin ComGG	-
SGO_RS09395 (SGO_1919)	comGF/cglF	1989358..1989795 (-)	438	WP_012130937.1	competence type IV pilus minor pilin ComGF	Machinery gene
SGO_RS09400 (SGO_1920)	comGE/cglE	1989779..1990072 (-)	294	WP_012130938.1	competence type IV pilus minor pilin ComGE	Machinery gene
SGO_RS09405 (SGO_1921)	comYD	1990044..1990472 (-)	429	WP_012130939.1	competence type IV pilus minor pilin ComGD	Machinery gene
SGO_RS09410 (SGO_1922)	comYC	1990432..1990749 (-)	318	WP_012130940.1	competence type IV pilus major pilin ComGC	Machinery gene
SGO_RS09415 (SGO_1923)	comYB	1990746..1991780 (-)	1035	WP_012130941.1	competence type IV pilus assembly protein ComGB	Machinery gene
SGO_RS09420 (SGO_1924)	comYA	1991692..1992651 (-)	960	WP_012130942.1	competence type IV pilus ATPase ComGA	Machinery gene
SGO_RS09425 (SGO_1925)	-	1992753..1993121 (-)	369	WP_012130943.1	DUF1033 family protein	-

Sequence

Protein

• Length: 142 a.a.
• Molecular weight: 16043.65 Da
• Isoelectric Point: 10.1975

>NTDB_id=432 SGO_RS09405 WP_012130939.1 1990044..1990472(-) (comYD) [Streptococcus gordonii str. Challis substr. CH1]
MVRTIVRLRQLPIKAFTVLESLLVLMISSFILLALSSSVQATFEQIQAKIFFLEFEHFYQESQKLSVSSQRKLVLEISSQ
EISNGYARLPIPKGIQAPESTQIYFDKAGGNSSLSKVQFQTKEGLVTYQLYIGNGKFKKTTN

Nucleotide

• Length: 429 bp

>NTDB_id=432 SGO_RS09405 WP_012130939.1 1990044..1990472(-) (comYD) [Streptococcus gordonii str. Challis substr. CH1]
ATGGTAAGAACAATAGTGAGACTCAGGCAGTTGCCAATTAAGGCCTTTACGGTTTTGGAAAGCCTCTTGGTCTTGATGAT
TAGCAGTTTTATCTTGCTGGCTTTATCAAGCTCTGTTCAAGCTACATTTGAACAGATTCAGGCAAAGATCTTCTTTTTAG
AATTTGAGCATTTTTATCAGGAAAGTCAGAAGCTTAGCGTATCTTCTCAGAGAAAGCTGGTGCTAGAAATATCCAGTCAA
GAGATTTCAAATGGTTATGCTCGTCTTCCAATTCCTAAAGGAATCCAAGCACCTGAATCTACACAGATCTATTTTGATAA
GGCTGGTGGTAATTCTTCACTCAGTAAAGTTCAGTTTCAAACCAAGGAAGGACTGGTGACCTATCAACTCTATATTGGAA
ATGGCAAATTTAAGAAAACGACAAATTAA

Domains

No domain identified.

3D structure

• AlphaFold DB: A8AZH7

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD/cglD	Streptococcus pneumoniae TIGR4	59.055	94.776	0.56
comGD/cglD	Streptococcus pneumoniae R6	59.055	94.776	0.56
comGD/cglD	Streptococcus pneumoniae D39	59.055	94.776	0.56
comGD/cglD	Streptococcus pneumoniae Rx1	59.055	94.776	0.56
comGD/cglD	Streptococcus mitis SK321	59.055	94.776	0.56
comGD/cglD	Streptococcus mitis NCTC 12261	55.97	94.366	0.528
comYD	Streptococcus mutans UA140	50.388	96.269	0.485
comYD	Streptococcus mutans UA159	50.388	96.269	0.485
comGD	Lactococcus lactis subsp. cremoris KW2	36.879	99.296	0.366

References

• [1]: R D Lunsford et al. (1997) comYA, a gene similar to comGA of Bacillus subtilis, is essential for competence-factor-dependent DNA transformation in Streptococcus gordonii. Journal of Bacteriology 179(10):3122-6. [PMID: 9150204]