Detailed information
Overview
| Name | comGD | Type | Machinery gene |
| Locus tag | SMU_RS09020 | Genome accession | NC_004350 |
| Coordinates | 1853553..1853957 (-) | Length | 134 a.a. |
| NCBI ID | WP_002263438.1 | Uniprot ID | - |
| Organism | Streptococcus mutans UA159 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus DNA binding and uptake |
||
Function
RT-PCR analysis of the orf junctions confirmed that all nine orfs of comY operon were present in a single transcript, while real-time RT-PCR analysis demonstrated that these orfs were expressed at a level very similar to that of the first orf in the operon. Mutations were constructed in all nine putative orfs. The first seven genes (comYA-G) were found to be essential for natural competence, while comYH and comYI had reduced and normal natural competence ability, respectively.
Genomic Context
Location: 1848553..1858957
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMU_RS08985 (SMU.1976c) | - | 1849011..1849451 (-) | 441 | WP_002263445.1 | hypothetical protein | - |
| SMU_RS08990 (SMU.1977c) | - | 1849420..1849665 (-) | 246 | WP_002263444.1 | helix-turn-helix transcriptional regulator | - |
| SMU_RS08995 (SMU.1978) | comGI | 1850234..1851433 (-) | 1200 | WP_002263443.1 | acetate kinase | Machinery gene |
| SMU_RS09000 (SMU.1979c) | comGH | 1851492..1852445 (-) | 954 | WP_002263442.1 | class I SAM-dependent methyltransferase | Machinery gene |
| SMU_RS09005 (SMU.1980c) | comGG | 1852500..1852889 (-) | 390 | WP_002263441.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| SMU_RS09010 (SMU.1981c) | comGF | 1852867..1853301 (-) | 435 | WP_002263440.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SMU_RS09015 (SMU.1982c) | comGE | 1853288..1853581 (-) | 294 | WP_002263439.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| SMU_RS09020 (SMU.1983) | comGD | 1853553..1853957 (-) | 405 | WP_002263438.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SMU_RS09025 (SMU.1984) | comGC | 1853944..1854258 (-) | 315 | WP_002263437.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SMU_RS09030 (SMU.1985) | comGB | 1854258..1855289 (-) | 1032 | WP_255262721.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SMU_RS09035 (SMU.1987) | comGA | 1855225..1856166 (-) | 942 | WP_002263435.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SMU_RS09040 (SMU.1988c) | - | 1856296..1856679 (-) | 384 | WP_002263434.1 | DUF1033 family protein | - |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| irvR | comGD | negative effect |
| irvR | comGC | negative effect |
| irvR | comGF | negative effect |
| irvR | comGG | negative effect |
| irvR | negative effect |
|
| irvR | dprA | negative effect |
| irvR | comGB | negative effect |
| irvR | comGE | negative effect |
| irvR | comGH | negative effect |
| irvR | comGI | negative effect |
| irvR | comGA | negative effect |
Sequence
Protein
Download Length: 134 a.a. Molecular weight: 15444.77 Da Isoelectric Point: 9.5619
MSRIKAFTLIESLVTLAITSFLILSFSGSITQTFAKVEERLFFLSFEHLYRDTQKLSVYQRQDMTLILKSEYISNGVEVL
KIPKDVKLERNKTLHFDQAGGNSSLEKLVFQTSDEKRVTYQLYIGSGQYKKTES
Nucleotide
Download Length: 405 bp
ATGTCGCGAATTAAAGCTTTTACGCTTATAGAAAGTTTAGTGACTTTGGCAATTACTAGTTTTTTGATTTTAAGCTTTTC
AGGTAGTATAACTCAAACGTTTGCCAAAGTAGAAGAGCGTCTCTTTTTTCTTTCTTTTGAACATCTTTACCGTGACACGC
AAAAACTTAGTGTTTATCAAAGACAAGATATGACTTTAATATTAAAAAGCGAATATATCTCAAATGGTGTTGAAGTACTT
AAAATCCCTAAGGATGTCAAACTAGAGAGGAATAAAACTTTGCACTTTGATCAGGCAGGAGGAAATTCTTCTTTAGAAAA
ACTTGTTTTTCAAACATCTGATGAAAAAAGAGTTACTTATCAATTATATATAGGAAGTGGTCAGTATAAAAAAACAGAAA
GTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD | Streptococcus mutans UA140 |
100 |
100 |
1 |
| comGD | Streptococcus gordonii str. Challis substr. CH1 |
50.388 |
96.269 |
0.485 |
| comGD/cglD | Streptococcus mitis NCTC 12261 |
49.612 |
96.269 |
0.478 |
| comGD/cglD | Streptococcus pneumoniae R6 |
49.219 |
95.522 |
0.47 |
| comGD/cglD | Streptococcus pneumoniae D39 |
49.219 |
95.522 |
0.47 |
| comGD/cglD | Streptococcus pneumoniae Rx1 |
49.219 |
95.522 |
0.47 |
| comGD/cglD | Streptococcus mitis SK321 |
48.438 |
95.522 |
0.463 |
| comGD/cglD | Streptococcus pneumoniae TIGR4 |
48.438 |
95.522 |
0.463 |
| comGD | Lactococcus lactis subsp. cremoris KW2 |
39.394 |
98.507 |
0.388 |
Multiple sequence alignment
References
| [1] | Justin Merritt et al. (2005) A unique nine-gene comY operon in Streptococcus mutans. Microbiology (Reading, England) 151(Pt 1):157-166. [PMID: 15632435] |