Detailed information    

experimental Experimentally validated

Overview


Name   braS   Type   Regulator
Locus tag   SA_RS13860 Genome accession   NC_002745
Coordinates   2713024..2713911 (-) Length   295 a.a.
NCBI ID   WP_000143425.1    Uniprot ID   -
Organism   Staphylococcus aureus N315     
Function   promote expression of competence genes   
Competence regulation

Function


Compared with the parental strain, expression of PcomG-gfp was increased approximately 2.5-fold in the Δ12 strain, significantly lowered (approximately 4-fold) in the Δ13 TCS mutant, and, in strain Δ17, expression was completely abolished, indicating that TCS17 is essential for comG expression under these conditions.


Genomic Context


Location: 2708024..2718911
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SA_RS13825 - 2708043..2708135 (+) 93 WP_010956583.1 hypothetical protein -
  SA_RS13830 (SA2414) - 2708243..2708740 (-) 498 WP_001065268.1 glutathione peroxidase -
  SA_RS13835 - 2708750..2709010 (-) 261 WP_078061229.1 hypothetical protein -
  SA_RS13840 - 2709392..2709505 (-) 114 Protein_2612 hypothetical protein -
  SA_RS13850 (SA2415) - 2710164..2712164 (-) 2001 WP_000776751.1 ABC transporter permease -
  SA_RS13855 (SA2416) - 2712161..2712916 (-) 756 WP_000923760.1 ABC transporter ATP-binding protein -
  SA_RS13860 (SA2417) braS 2713024..2713911 (-) 888 WP_000143425.1 nisin susceptibility-associated two-component system sensor histidine kinase NsaS Regulator
  SA_RS13865 (SA2418) braR 2713922..2714587 (-) 666 WP_000697877.1 nisin susceptibility-associated two-component system response regulator NsaR Regulator
  SA_RS13870 (SA2419) - 2714613..2714813 (-) 201 WP_000604730.1 hypothetical protein -
  SA_RS13880 (SA2420) - 2715011..2716435 (+) 1425 WP_000953755.1 alkaline phosphatase -
  SA_RS15560 - 2716495..2716596 (-) 102 WP_000731976.1 SE2200 family small protein -
  SA_RS13885 (SA2421) - 2716718..2717173 (-) 456 WP_000106185.1 MarR family winged helix-turn-helix transcriptional regulator -
  SA_RS13890 (SA2422) - 2717418..2718179 (-) 762 WP_000323441.1 alpha/beta hydrolase -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  braS comGD positive effect
  agrC comGD positive effect
  agrC comGB positive effect
  agrC comGC positive effect
  agrC comGE positive effect
  agrC comGA positive effect
  agrC comGF positive effect
  braS comGB positive effect
  braS comGC positive effect
  braS comGE positive effect
  braS comGA positive effect
  braS comGF positive effect
  sigH comGD positive effect
  sigH comGA positive effect
  sigH comGF positive effect
  sigH comGC positive effect
  sigH comGE positive effect
  sigH coiA positive effect
  sigH positive effect
  sigH comEA positive effect
  sigH ssb positive effect
  sigH comGB positive effect
  sigH dprA positive effect
  braR comGD positive effect
  braR comGB positive effect
  braR comGA positive effect
  braR comGF positive effect
  braR comGC positive effect
  braR comGE positive effect
  vraR comGD negative effect
  vraR comGA negative effect
  vraR comGF negative effect
  vraR comGB negative effect
  vraR comGC negative effect
  vraR comGE negative effect
  agrA comGD positive effect
  agrA comGA positive effect
  agrA comGF positive effect
  agrA comGB positive effect
  agrA comGC positive effect
  agrA comGE positive effect
  comK/comK1 comGD positive effect
  comK/comK1 comGE positive effect
  comK/comK1 coiA positive effect
  comK/comK1 positive effect
  comK/comK1 comEA positive effect
  comK/comK1 ssb positive effect
  comK/comK1 comGB positive effect
  comK/comK1 dprA positive effect
  comK/comK1 comGA positive effect
  comK/comK1 comGF positive effect
  comK/comK1 comGC positive effect
  vraS comGD negative effect
  vraS comGC negative effect
  vraS comGE negative effect
  vraS comGA negative effect
  vraS comGF negative effect
  vraS comGB negative effect

Sequence


Protein


Download         Length: 295 a.a.        Molecular weight: 34006.28 Da        Isoelectric Point: 6.0874

>NTDB_id=8 SA_RS13860 WP_000143425.1 2713024..2713911(-) (braS) [Staphylococcus aureus N315]
MTFLKSITQEIAIVIVIFALFGLMFYLYHLPLEAYLLALGVILLLLLIFIGIKYLSFVKTISQQQQIENLETALYQLKNE
QIEYKNDVESYFLTWVHQMKTPITAAQLLLERDEPNVVNRVRQEVIQIDNYTSLALSYLKLLNETSDISVTKISINNIIR
PIIMKYSIQFIDQKTKIHYEPCHHEVLTDVRWTSLMIEQLINNALKYARGKDIWIEFDEQSNQLHVKDNGIGISEADLPK
IFDKGYSGYNGQRQSNSSGIGLFIVKQISTHTNHPVSVVSKQNEGTTFTIQFPDE

Nucleotide


Download         Length: 888 bp        

>NTDB_id=8 SA_RS13860 WP_000143425.1 2713024..2713911(-) (braS) [Staphylococcus aureus N315]
ATGACCTTTCTTAAAAGTATTACTCAGGAAATAGCAATAGTCATAGTTATTTTTGCTTTATTTGGCTTAATGTTTTACCT
GTATCATTTGCCATTAGAAGCATATTTACTAGCACTTGGCGTTATTTTATTATTATTACTCATATTCATAGGTATTAAAT
ATTTAAGTTTTGTAAAAACTATAAGCCAACAACAACAAATTGAAAACTTAGAAACTGCGTTGTATCAGCTTAAAAATGAA
CAAATTGAATATAAAAATGATGTAGAGAGCTACTTTTTAACATGGGTACATCAAATGAAAACACCCATTACTGCAGCACA
ACTGTTACTTGAAAGAGATGAGCCTAATGTTGTTAATCGTGTTCGTCAAGAGGTTATTCAAATTGATAACTATACAAGTT
TAGCACTTAGTTATTTAAAGTTATTAAATGAAACTTCTGATATTTCTGTCACTAAAATTTCGATTAATAATATCATTCGC
CCAATTATTATGAAATATTCAATACAGTTTATTGATCAAAAAACAAAAATCCATTATGAACCTTGTCATCACGAAGTATT
AACTGACGTTAGATGGACCTCTTTAATGATAGAACAATTAATAAATAATGCACTTAAGTATGCGAGAGGTAAAGATATAT
GGATTGAATTTGATGAGCAATCCAATCAATTACACGTAAAAGATAATGGTATCGGTATTAGTGAAGCGGACTTGCCTAAA
ATATTTGATAAGGGCTATTCAGGTTATAATGGCCAGCGCCAAAGTAACTCAAGTGGGATTGGTTTATTTATCGTAAAACA
AATTTCAACACACACAAACCATCCTGTTTCAGTCGTATCTAAACAAAATGAGGGTACAACATTTACGATTCAATTTCCAG
ATGAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] Mais Maree et al. (2022) Natural transformation allows transfer of SCCmec-mediated methicillin resistance in Staphylococcus aureus biofilms. Nature Communications 13(1):2477. [PMID: 35513365]