Detailed information NTG0000007

Experimentally validated

Overview

• Name: agrA
• Type: Regulator
• Locus tag: SA_RS10585
• Genome accession: NC_002745
• Coordinates: 2081487..2082203 (+)
• Length: 238 a.a.
• NCBI ID: WP_000688492.1
• Uniprot ID: A0A7U7IEW1
• Organism: Staphylococcus aureus N315
• Function: promote expression of competence genes Competence regulation

Function

Compared with the parental strain, expression of PcomG-gfp was increased approximately 2.5-fold in the Δ12 strain, significantly lowered (approximately 4-fold) in the Δ13 TCS mutant, and, in strain Δ17, expression was completely abolished, indicating that TCS17 is essential for comG expression under these conditions.

Genomic Context

Location: 2076487..2087203

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SA_RS10555 (SA1840)	-	2076704..2077330 (+)	627	WP_000522381.1	nitroreductase family protein	-
SA_RS10560 (SA1841)	-	2077691..2078476 (+)	786	WP_000867951.1	carbon-nitrogen family hydrolase	-
SA_RS15530	hld	2079076..2079156 (-)	81	WP_000046022.1	delta-hemolysin	-
SA_RS10570 (SA1842)	-	2079446..2080009 (+)	564	WP_001105696.1	accessory gene regulator AgrB	-
SA_RS10575 (SAS066)	agrD	2080012..2080155 (+)	144	WP_001094921.1	cyclic lactone autoinducer peptide AgrD	-
SA_RS10580 (SA1843)	agrC	2080185..2081468 (+)	1284	Protein_1985	quorum-sensing sensor histidine kinase AgrC	Regulator
SA_RS10585 (SA1844)	agrA	2081487..2082203 (+)	717	WP_000688492.1	quorum-sensing response regulator AgrA	Regulator
SA_RS10590	-	2082275..2082384 (+)	110	Protein_1987	hypothetical protein	-
SA_RS10595 (SA1845)	-	2082572..2083531 (-)	960	WP_001253312.1	carbohydrate kinase family protein	-
SA_RS10600 (SA1846)	-	2083528..2085012 (-)	1485	WP_000141432.1	sucrose-6-phosphate hydrolase	-
SA_RS10605 (SA1847)	-	2085161..2086111 (-)	951	WP_000790331.1	LacI family DNA-binding transcriptional regulator	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
agrA	comGA	positive effect
agrA	comGF	positive effect
agrA	comGB	positive effect
agrA	comGC	positive effect
agrA	comGE	positive effect
agrA	comGD	positive effect
comK/comK1	comGA	positive effect
comK/comK1	comGE	positive effect
comK/comK1	coiA	positive effect
comK/comK1		positive effect
comK/comK1	comGD	positive effect
comK/comK1	comEA	positive effect
comK/comK1	ssb	positive effect
comK/comK1	comGB	positive effect
comK/comK1	dprA	positive effect
comK/comK1	comGF	positive effect
comK/comK1	comGC	positive effect
vraR	comGA	negative effect
vraR	comGF	negative effect
vraR	comGB	negative effect
vraR	comGC	negative effect
vraR	comGE	negative effect
vraR	comGD	negative effect
vraS	comGA	negative effect
vraS	comGC	negative effect
vraS	comGE	negative effect
vraS	comGD	negative effect
vraS	comGF	negative effect
vraS	comGB	negative effect
sigH	comGA	positive effect
sigH	comGD	positive effect
sigH	comGF	positive effect
sigH	comGC	positive effect
sigH	comGE	positive effect
sigH	coiA	positive effect
sigH		positive effect
sigH	comEA	positive effect
sigH	ssb	positive effect
sigH	comGB	positive effect
sigH	dprA	positive effect
agrC	comGA	positive effect
agrC	comGD	positive effect
agrC	comGB	positive effect
agrC	comGC	positive effect
agrC	comGE	positive effect
agrC	comGF	positive effect
braS	comGA	positive effect
braS	comGD	positive effect
braS	comGB	positive effect
braS	comGC	positive effect
braS	comGE	positive effect
braS	comGF	positive effect
braR	comGA	positive effect
braR	comGB	positive effect
braR	comGD	positive effect
braR	comGF	positive effect
braR	comGC	positive effect
braR	comGE	positive effect

Sequence

Protein

• Length: 238 a.a.
• Molecular weight: 27905.90 Da
• Isoelectric Point: 6.0927

>NTDB_id=7 SA_RS10585 WP_000688492.1 2081487..2082203(+) (agrA) [Staphylococcus aureus N315]
MKIFICEDDPKQRENMVTIIKNYIMIEEKPMEIALATDNPYEVLEQAKNMNDIGCYFLDIQLSTDINGIKLGSEIRKHDP
VGNIIFVTSHSELTYLTFVYKVAAMDFIFKDDPAELRTRIIDCLETAHTRLQLLSKDNSVETIELKRGSNSVYVQYDDIM
FFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI

Nucleotide

• Length: 717 bp

>NTDB_id=7 SA_RS10585 WP_000688492.1 2081487..2082203(+) (agrA) [Staphylococcus aureus N315]
ATGAAAATTTTCATTTGCGAAGACGATCCAAAACAAAGAGAAAACATGGTTACCATTATTAAAAATTATATAATGATAGA
AGAAAAGCCTATGGAAATTGCCCTCGCAACTGATAATCCTTATGAGGTGCTTGAGCAAGCTAAAAATATGAATGACATAG
GCTGTTACTTTTTAGATATTCAACTTTCAACTGATATTAATGGTATCAAATTAGGCAGTGAAATTCGTAAGCATGACCCA
GTTGGTAACATTATTTTCGTTACGAGTCACAGTGAACTTACCTATTTAACATTTGTCTACAAAGTTGCAGCGATGGATTT
TATTTTTAAAGATGATCCAGCAGAATTAAGAACTCGAATTATAGATTGTTTAGAAACTGCACATACACGCTTACAATTGT
TGTCTAAAGATAATAGCGTTGAAACGATTGAATTAAAACGTGGCAGTAATTCAGTGTATGTTCAATATGATGATATTATG
TTTTTTGAATCATCAACAAAATCTCACAGACTCATTGCCCATTTAGATAACCGTCAAATTGAATTTTATGGTAATTTAAA
AGAACTGAGTCAATTAGATGATCGTTTCTTTAGATGTCATAATAGCTTTGTCGTCAATCGCCATAATATTGAATCTATAG
ATTCGAAAGAGCGAATTGTCTATTTTAAAAATAAAGAACACTGCTATGCATCGGTGAGAAACGTTAAAAAAATATAA

Domains

Predicted by InterproScan.

• Response regulator receiver domain (Response_reg) (3-120)

• LytTr DNA-binding domain (LytTR) (151-237)

3D structure

• AlphaFold DB: A0A7U7IEW1

References

• [1]: Mais Maree et al. (2022) Natural transformation allows transfer of SCCmec-mediated methicillin resistance in Staphylococcus aureus biofilms. Nature Communications 13(1):2477. [PMID: 35513365]