Detailed information    

experimental Experimentally validated

Overview


Name   agrA   Type   Regulator
Locus tag   SA_RS10585 Genome accession   NC_002745
Coordinates   2081487..2082203 (+) Length   238 a.a.
NCBI ID   WP_000688492.1    Uniprot ID   P0A0I7
Organism   Staphylococcus aureus N315     
Function   promote expression of competence genes   
Competence regulation

Function


Compared with the parental strain, expression of PcomG-gfp was increased approximately 2.5-fold in the Δ12 strain, significantly lowered (approximately 4-fold) in the Δ13 TCS mutant, and, in strain Δ17, expression was completely abolished, indicating that TCS17 is essential for comG expression under these conditions.


Genomic Context


Location: 2076487..2087203
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SA_RS10555 (SA1840) - 2076704..2077330 (+) 627 WP_000522381.1 nitroreductase family protein -
  SA_RS10560 (SA1841) - 2077691..2078476 (+) 786 WP_000867951.1 carbon-nitrogen family hydrolase -
  SA_RS15530 hld 2079076..2079156 (-) 81 WP_000046022.1 delta-hemolysin -
  SA_RS10570 (SA1842) - 2079446..2080009 (+) 564 WP_001105696.1 accessory gene regulator AgrB -
  SA_RS10575 (SAS066) agrD 2080012..2080155 (+) 144 WP_001094921.1 cyclic lactone autoinducer peptide AgrD -
  SA_RS10580 (SA1843) agrC 2080185..2081468 (+) 1284 Protein_1985 quorum-sensing sensor histidine kinase AgrC Regulator
  SA_RS10585 (SA1844) agrA 2081487..2082203 (+) 717 WP_000688492.1 quorum-sensing response regulator AgrA Regulator
  SA_RS10590 - 2082275..2082384 (+) 110 Protein_1987 hypothetical protein -
  SA_RS10595 (SA1845) - 2082572..2083531 (-) 960 WP_001253312.1 carbohydrate kinase family protein -
  SA_RS10600 (SA1846) - 2083528..2085012 (-) 1485 WP_000141432.1 sucrose-6-phosphate hydrolase -
  SA_RS10605 (SA1847) - 2085161..2086111 (-) 951 WP_000790331.1 LacI family DNA-binding transcriptional regulator -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  agrA comGA positive effect
  agrA comGF positive effect
  agrA comGB positive effect
  agrA comGC positive effect
  agrA comGE positive effect
  agrA comGD positive effect
  comK/comK1 comGA positive effect
  comK/comK1 comGE positive effect
  comK/comK1 coiA positive effect
  comK/comK1 positive effect
  comK/comK1 comGD positive effect
  comK/comK1 comEA positive effect
  comK/comK1 ssb positive effect
  comK/comK1 comGB positive effect
  comK/comK1 dprA positive effect
  comK/comK1 comGF positive effect
  comK/comK1 comGC positive effect
  vraR comGA negative effect
  vraR comGF negative effect
  vraR comGB negative effect
  vraR comGC negative effect
  vraR comGE negative effect
  vraR comGD negative effect
  vraS comGA negative effect
  vraS comGC negative effect
  vraS comGE negative effect
  vraS comGD negative effect
  vraS comGF negative effect
  vraS comGB negative effect
  sigH comGA positive effect
  sigH comGD positive effect
  sigH comGF positive effect
  sigH comGC positive effect
  sigH comGE positive effect
  sigH coiA positive effect
  sigH positive effect
  sigH comEA positive effect
  sigH ssb positive effect
  sigH comGB positive effect
  sigH dprA positive effect
  agrC comGA positive effect
  agrC comGD positive effect
  agrC comGB positive effect
  agrC comGC positive effect
  agrC comGE positive effect
  agrC comGF positive effect
  braS comGA positive effect
  braS comGD positive effect
  braS comGB positive effect
  braS comGC positive effect
  braS comGE positive effect
  braS comGF positive effect
  braR comGA positive effect
  braR comGB positive effect
  braR comGD positive effect
  braR comGF positive effect
  braR comGC positive effect
  braR comGE positive effect

Sequence


Protein


Download         Length: 238 a.a.        Molecular weight: 27905.90 Da        Isoelectric Point: 6.0927

>NTDB_id=7 SA_RS10585 WP_000688492.1 2081487..2082203(+) (agrA) [Staphylococcus aureus N315]
MKIFICEDDPKQRENMVTIIKNYIMIEEKPMEIALATDNPYEVLEQAKNMNDIGCYFLDIQLSTDINGIKLGSEIRKHDP
VGNIIFVTSHSELTYLTFVYKVAAMDFIFKDDPAELRTRIIDCLETAHTRLQLLSKDNSVETIELKRGSNSVYVQYDDIM
FFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI

Nucleotide


Download         Length: 717 bp        

>NTDB_id=7 SA_RS10585 WP_000688492.1 2081487..2082203(+) (agrA) [Staphylococcus aureus N315]
ATGAAAATTTTCATTTGCGAAGACGATCCAAAACAAAGAGAAAACATGGTTACCATTATTAAAAATTATATAATGATAGA
AGAAAAGCCTATGGAAATTGCCCTCGCAACTGATAATCCTTATGAGGTGCTTGAGCAAGCTAAAAATATGAATGACATAG
GCTGTTACTTTTTAGATATTCAACTTTCAACTGATATTAATGGTATCAAATTAGGCAGTGAAATTCGTAAGCATGACCCA
GTTGGTAACATTATTTTCGTTACGAGTCACAGTGAACTTACCTATTTAACATTTGTCTACAAAGTTGCAGCGATGGATTT
TATTTTTAAAGATGATCCAGCAGAATTAAGAACTCGAATTATAGATTGTTTAGAAACTGCACATACACGCTTACAATTGT
TGTCTAAAGATAATAGCGTTGAAACGATTGAATTAAAACGTGGCAGTAATTCAGTGTATGTTCAATATGATGATATTATG
TTTTTTGAATCATCAACAAAATCTCACAGACTCATTGCCCATTTAGATAACCGTCAAATTGAATTTTATGGTAATTTAAA
AGAACTGAGTCAATTAGATGATCGTTTCTTTAGATGTCATAATAGCTTTGTCGTCAATCGCCATAATATTGAATCTATAG
ATTCGAAAGAGCGAATTGTCTATTTTAAAAATAAAGAACACTGCTATGCATCGGTGAGAAACGTTAAAAAAATATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  PDB 3BS1
  PDB 4G4K

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] Mais Maree et al. (2022) Natural transformation allows transfer of SCCmec-mediated methicillin resistance in Staphylococcus aureus biofilms. Nature Communications 13(1):2477. [PMID: 35513365]