Detailed information    

experimental Experimentally validated

Overview


Name   comQ   Type   Regulator
Locus tag   BSU_31710 Genome accession   NC_000964
Coordinates   3256008..3256907 (-) Length   299 a.a.
NCBI ID   NP_391049.2    Uniprot ID   P33690
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   modification of ComX; production of ComX   
Competence regulation

Function


ComQ is involved in the production and modification of the ComX pheromone, a signaling molecule that activates competence development.


Genomic Context


Location: 3251008..3261907
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_31640 (BSU31640) mrpE 3251248..3251724 (+) 477 YP_054591.2 non essential component of Na+/H+ antiporter -
  BSU_31650 (BSU31650) mrpF 3251724..3252008 (+) 285 NP_391043.2 efflux transporter for Na+ and cholate -
  BSU_31660 (BSU31660) mrpG 3251992..3252366 (+) 375 NP_391044.1 non essential component of Na+/H+ antiporter -
  BSU_31670 (BSU31670) yuxO 3252405..3252785 (-) 381 NP_391045.2 putative proofreading thioesterase in bacillibactin biosynthesis -
  BSU_31680 (BSU31680) comA 3252804..3253448 (-) 645 NP_391046.1 two-component response quorum-sensing regulator Regulator
  BSU_31690 (BSU31690) comP 3253529..3255838 (-) 2310 NP_391047.2 two-component sensor histidine kinase Regulator
  BSU_31700 (BSU31700) comX 3255853..3256020 (-) 168 NP_391048.1 competence pheromone precursor (pheromone peptide aa 46->55, geranyl-modified) Regulator
  BSU_31710 (BSU31710) comQ 3256008..3256907 (-) 900 NP_391049.2 isoprenyl transferase (pre-ComX modification) Regulator
  BSU_31720 (BSU31720) degQ 3257092..3257232 (-) 141 NP_391050.1 pleiotropic regulator Regulator
  BSU_31725 (BSU31725) - 3257454..3257579 (+) 126 YP_009514001.1 hypothetical protein -
  BSU_31730 (BSU31730) cotIC 3257693..3258061 (+) 369 NP_391051.2 inner spore coat protein -
  BSU_31740 (BSU31740) pdeH 3258037..3259266 (-) 1230 NP_391052.1 cyclic di-GMP phosphodiesterase -
  BSU_31750 (BSU31750) pncB 3259403..3260875 (-) 1473 NP_391053.1 nicotinate phosphoribosyltransferase -
  BSU_31760 (BSU31760) pncA 3260891..3261442 (-) 552 NP_391054.1 nicotinamidase; NAD salvage pathway -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  comQ comX positive effect
  comX comP positive effect
  comP comA positive effect
  comA comS positive effect
  comS comK positive effect
  comK comK positive effect
  comK late competence genes positive effect
  codY comK negative effect
  clpP comK negative effect
  mecA comK negative effect
  kre comK negative effect
  abrB comK negative effect
  spo0A comK positive effect
  rok comK negative effect
  degU comK positive effect
  clpC comK negative effect
  med comK positive effect
  spo0A comK negative effect
  comK late competence genes positive effect
  clpP degU negative effect
  abrB rok negative effect
  spo0A abrB negative effect
  spo0A rok negative effect
  ylbF spo0A positive effect
  ymcA spo0A positive effect
  sinR spo0A negative effect
  yaaT spo0A positive effect
  sinR rok negative effect
  sinR degU negative effect
  degQ degU positive effect
  clpC degU negative effect
  degS degU positive effect
  rapC comA negative effect
  rapF comA negative effect
  sinI sinR negative effect
  phrC rapC negative effect
  phrF rapF negative effect

Sequence


Protein


Download         Length: 299 a.a.        Molecular weight: 34218.11 Da        Isoelectric Point: 4.8304

>NTDB_id=93 BSU_31710 NP_391049.2 3256008..3256907(-) (comQ) [Bacillus subtilis subsp. subtilis str. 168]
MKEIVEQNIFNEDLSQLLYSFIDSKETFSFAESTILHYVVFGGENLDVATRLGAGIEILILSSDIMDDLEDEDNHHALWM
KINRSESLNAALSLYTVGLTSIYSLNNNPLIFKYVLKYVNEAMQGQHDDITNKSKTEDESLEVIRLKCGSLIALANVAGV
LLATGEYNETVERYSYYKGIIAQISGDYYVLLSGNRSDIEKNKHTLIYLYLKRLFNDASEDLLYLISHKDLYYKSLLDKE
KFQEKLIKAGVTQYISVLLEIYKQKCISAIEQLNLDKEKKELIKECLLSYTKGDTRCKT

Nucleotide


Download         Length: 900 bp        

>NTDB_id=93 BSU_31710 NP_391049.2 3256008..3256907(-) (comQ) [Bacillus subtilis subsp. subtilis str. 168]
ATGAAGGAGATTGTGGAGCAAAACATATTTAACGAGGATTTGTCACAACTTCTTTACTCATTTATTGATTCTAAAGAAAC
ATTCTCCTTTGCTGAATCCACAATCTTACATTATGTTGTTTTTGGAGGGGAGAATTTAGATGTTGCAACAAGGCTTGGCG
CGGGAATAGAAATTCTTATTCTTTCATCAGATATTATGGATGATCTTGAAGATGAAGATAATCACCATGCATTATGGATG
AAAATTAATCGCTCGGAGTCGTTAAATGCAGCACTTTCCTTGTATACAGTAGGATTAACGAGTATTTATTCATTAAATAA
CAATCCTCTAATTTTTAAATATGTTTTAAAATACGTAAACGAGGCCATGCAAGGTCAACATGACGATATCACTAATAAAT
CTAAAACAGAAGATGAAAGTTTAGAAGTAATTAGATTAAAATGTGGAAGTCTGATTGCACTAGCAAATGTAGCAGGTGTT
TTATTGGCTACAGGAGAATATAATGAAACAGTTGAAAGATATTCCTACTATAAAGGGATTATAGCTCAAATTTCTGGAGA
TTATTATGTTCTTTTATCCGGAAATCGCAGTGATATTGAAAAAAACAAACATACACTGATTTACTTATATCTTAAGCGCC
TTTTTAATGATGCTTCGGAAGATTTATTATACTTAATTTCACATAAAGACTTATATTATAAATCGTTACTTGATAAAGAG
AAATTCCAAGAAAAATTAATTAAAGCGGGAGTTACTCAATACATTTCGGTATTATTGGAAATATATAAACAGAAATGTAT
TTCTGCTATAGAACAATTAAATTTAGATAAAGAAAAAAAAGAGCTAATAAAGGAATGCTTATTAAGTTATACAAAGGGGG
ATACAAGATGCAAGACCTAA

Domains


Predicted by InterProScan.

(44-218)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P33690

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] Anna Oslizlo et al. (2014) Private link between signal and response in Bacillus subtilis quorum sensing. Proceedings of The National Academy of Sciences of The United States of America 111(4):1586-91. [PMID: 24425772]
[2] Natalia Comella et al. (2005) Conservation of genes and processes controlled by the quorum response in bacteria: characterization of genes controlled by the quorum-sensing transcription factor ComA in Bacillus subtilis. Molecular Microbiology 57(4):1159-74. [PMID: 16091051]
[3] M Ansaldi et al. (2004) Diversifying selection at the Bacillus quorum-sensing locus and determinants of modification specificity during synthesis of the ComX pheromone. Journal of Bacteriology 186(1):15-21. [PMID: 14679219]
[4] Katherine Bacon Schneider et al. (2002) Characterization of comQ and comX, two genes required for production of ComX pheromone in Bacillus subtilis. Journal of Bacteriology 184(2):410-9. [PMID: 11751817]
[5] Mireille Ansaldi et al. (2002) Specific activation of the Bacillus quorum-sensing systems by isoprenylated pheromone variants. Molecular Microbiology 44(6):1561-73. [PMID: 12067344]
[6] R Magnuson et al. (1994) Biochemical and genetic characterization of a competence pheromone from B. subtilis. Cell 77(2):207-16. [PMID: 8168130]
[7] Y Weinrauch et al. (1991) Sequence and properties of comQ, a new competence regulatory gene of Bacillus subtilis. Journal of Bacteriology 173(18):5685-93. [PMID: 1715859]