Detailed information    

experimental Experimentally validated

Overview

Name   rok   Type   Regulator
Locus tag   BSU_14240 Genome accession   NC_000964
Coordinates   1493787..1494362 (+) Length   191 a.a.
NCBI ID   NP_389307.1    Uniprot ID   O34857
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   repression of comK   
Competence regulation

Function

In the natural transformation process of Bacillus subtilis, the rok gene encodes a transcriptional regulator that plays a significant role in controlling competence development. Specifically, Rok (also known as YkuW) directly represses the expression of the comK gene, which is the master regulator of competence. By repressing comK, Rok negatively regulates the expression of downstream competence genes involved in DNA uptake and recombination. Additionally, Rok is known to repress genes encoding cell surface and secreted proteins, further influencing the competence state.


Genomic Context

Location: 1488787..1499362
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_14180 (BSU14180) dapH 1488973..1489683 (+) 711 NP_389301.2 tetrahydrodipicolinate N-acetyltransferase -
  BSU_14190 (BSU14190) dapI 1489753..1490877 (+) 1125 NP_389302.1 N-acetyl-diaminopimelate deacetylase -
  BSU_14200 (BSU14200) ykuS 1490939..1491184 (+) 246 NP_389303.1 hypothetical protein -
  BSU_14210 (BSU14210) mscT 1491221..1492024 (-) 804 NP_389304.2 small-conductance mechanosensitive channel -
  BSU_14220 (BSU14220) ahpA 1492261..1492803 (+) 543 NP_389305.1 biofilm-specific peroxidase; 2-cys peroxiredoxin -
  BSU_14230 (BSU14230) ykuV 1492875..1493321 (+) 447 NP_389306.2 thiol-disulfide oxidoreductase -
  BSU_14240 (BSU14240) rok 1493787..1494362 (+) 576 NP_389307.1 repressor of comK Regulator
  BSU_14250 (BSU14250) sppO 1494403..1495368 (-) 966 NP_389308.1 spore protein cse15 -
  BSU_14260 (BSU14260) mobA 1495505..1496104 (+) 600 NP_389309.1 molybdopterin-guanine dinucleotide biosynthesis protein A -
  BSU_14270 (BSU14270) moeB 1496155..1497174 (+) 1020 NP_389310.1 molybdopterin biosynthesis adenylyltransferase -
  BSU_14280 (BSU14280) moeA 1497192..1498484 (+) 1293 NP_389311.1 molybdate to molybdopterin ligation enzyme -
  BSU_14290 (BSU14290) mobB 1498445..1498966 (+) 522 NP_389312.1 molybdopterin-guanine dinucleotide biosynthesis protein B -

Regulatory network

Positive effect      
Negative effect
Regulator Target Regulation
  rok comK negative effect
  comK comK positive effect
  comK late competence genes positive effect
  codY comK negative effect
  clpP comK negative effect
  mecA comK negative effect
  kre comK negative effect
  abrB comK negative effect
  comS comK positive effect
  spo0A comK positive effect
  degU comK positive effect
  clpC comK negative effect
  med comK positive effect
  spo0A comK negative effect
  comK late competence genes positive effect
  clpP degU negative effect
  abrB rok negative effect
  spo0A abrB negative effect
  comA comS positive effect
  spo0A rok negative effect
  sinR spo0A negative effect
  sinR rok negative effect
  sinR degU negative effect
  degQ degU positive effect
  clpC degU negative effect
  degS degU positive effect
  rapC comA negative effect
  rapF comA negative effect
  comP comA positive effect
  sinI sinR negative effect
  phrC rapC negative effect
  phrF rapF negative effect
  comX comP positive effect
  comQ comX positive effect

Sequence

Protein


Download         Length: 191 a.a.        Molecular weight: 21839.85 Da        Isoelectric Point: 9.8633

>NTDB_id=79 BSU_14240 NP_389307.1 1493787..1494362(+) (rok) [Bacillus subtilis subsp. subtilis str. 168]
MFNEREALRLRLEQLNEAEVKVIREYQIERDKIYAKLRELDRNGSPSEIKKDFRSEKKPDSLPVLAELAAQEIRSYQPQS
QQQSVQPQLQSISSLPAGIPDGTTRRRRGTARPGSKAAKLREAAIKTLKRHNAAIKSSELQKEIEKESGLEIPNMTTFMQ
SLIKMYPEVKKPYRGQYILEGEIESAESANE

Nucleotide


Download         Length: 576 bp        

>NTDB_id=79 BSU_14240 NP_389307.1 1493787..1494362(+) (rok) [Bacillus subtilis subsp. subtilis str. 168]
ATGTTTAATGAAAGAGAAGCTTTGCGCTTGCGGTTAGAACAATTAAATGAAGCTGAAGTGAAAGTCATTCGTGAATATCA
AATTGAACGTGATAAAATATACGCAAAATTAAGAGAGCTGGACAGAAATGGAAGCCCTTCCGAAATCAAAAAGGATTTCC
GTTCTGAAAAAAAACCTGACTCTCTGCCGGTTCTCGCTGAGCTTGCGGCTCAGGAAATCAGAAGCTATCAGCCGCAATCA
CAGCAGCAGTCTGTTCAGCCTCAGCTTCAATCTATTTCCTCTCTTCCTGCCGGTATACCAGACGGAACAACACGAAGAAG
AAGAGGAACGGCAAGACCGGGATCAAAAGCAGCTAAGCTGCGTGAAGCTGCTATTAAAACATTAAAACGCCACAACGCGG
CGATTAAGAGCTCGGAGCTTCAAAAAGAGATTGAAAAAGAAAGCGGTCTTGAAATCCCTAATATGACAACGTTTATGCAA
AGCTTAATTAAAATGTACCCGGAAGTGAAAAAGCCATATCGCGGGCAGTACATTTTAGAGGGTGAAATCGAATCTGCAGA
ATCAGCAAACGAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  PDB 5ZUX
  PDB 5ZUZ

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References

[1] Gaurav Dugar et al. (2022) A chromosomal loop anchor mediates bacterial genome organization. Nature Genetics 54(2):194-201. [PMID: 35075232]
[2] Charlotte A Seid et al. (2017) Genetic and biochemical interactions between the bacterial replication initiator DnaA and the nucleoid-associated protein Rok in Bacillus subtilis. Molecular Microbiology 103(5):798-817. [PMID: 27902860]
[3] Mark Albano et al. (2005) The Rok protein of Bacillus subtilis represses genes for cell surface and extracellular functions. Journal of Bacteriology 187(6):2010-9. [PMID: 15743949]
[4] Hédia Maamar et al. (2005) Bistability in the Bacillus subtilis K-state (competence) system requires a positive feedback loop. Molecular Microbiology 56(3):615-24. [PMID: 15819619]
[5] Tran Thu Hoa et al. (2002) Rok (YkuW) regulates genetic competence in Bacillus subtilis by directly repressing comK. Molecular Microbiology 43(1):15-26. [PMID: 11849533]