Detailed information
Overview
| Name | sinR | Type | Regulator |
| Locus tag | BSU_24610 | Genome accession | NC_000964 |
| Coordinates | 2552653..2552988 (+) | Length | 111 a.a. |
| NCBI ID | NP_390341.1 | Uniprot ID | P06533 |
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
| Function | repression of rok; repression of degU; repression of spo0A Competence regulation |
||
Function
In Bacillus subtilis, the sinR gene encodes a pleiotropic DNA-binding protein that acts as a key regulator of multiple developmental processes, including competence development and sporulation. SinR is known to repress the expression of the spo0A gene, which is essential for initiating sporulation and competence. By repressing spo0A, SinR indirectly affects the expression of comK, the master regulator of competence, thereby influencing the natural transformation process. Studies have also shown that SinR can repress the expression of the gene degU and rok.
Genomic Context
Location: 2547653..2557988
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BSU_24570 (BSU24570) | gcvT | 2548245..2549333 (-) | 1089 | NP_390337.2 | aminomethyltransferase (glycine cleavage system protein T) | - |
| BSU_24580 (BSU24580) | yqhH | 2549775..2551448 (+) | 1674 | NP_390338.1 | putative RNA polymerase-associated helicase protein | - |
| BSU_24590 (BSU24590) | yqhG | 2551469..2552263 (+) | 795 | NP_390339.1 | hypothetical protein | - |
| BSU_24600 (BSU24600) | sinI | 2552446..2552619 (+) | 174 | NP_390340.1 | antagonist of SinR | Regulator |
| BSU_24610 (BSU24610) | sinR | 2552653..2552988 (+) | 336 | NP_390341.1 | master regulator of biofilm formation | Regulator |
| BSU_24620 (BSU24620) | tasA | 2553081..2553866 (-) | 786 | NP_390342.1 | major biofilm matrix component | - |
| BSU_24630 (BSU24630) | sipW | 2553930..2554502 (-) | 573 | NP_390343.1 | type I signal peptidase | - |
| BSU_24640 (BSU24640) | tapA | 2554486..2555247 (-) | 762 | NP_390344.1 | lipoprotein for biofilm formation | - |
| BSU_24650 (BSU24650) | yqzG | 2555519..2555845 (+) | 327 | NP_390345.1 | hypothetical protein | - |
| BSU_24660 (BSU24660) | spoIIT | 2555887..2556066 (-) | 180 | NP_390346.2 | factor involved in sporulation | - |
| BSU_24670 (BSU24670) | comGG | 2556137..2556511 (-) | 375 | NP_390347.1 | component of the DNA transport pilin platform | Machinery gene |
| BSU_24680 (BSU24680) | comGF | 2556512..2556895 (-) | 384 | NP_390348.1 | component of the DNA transport pilin platform | Machinery gene |
| BSU_24690 (BSU24690) | comGE | 2556921..2557268 (-) | 348 | NP_390349.1 | component of the DNA transport pilin platform | Machinery gene |
| BSU_24700 (BSU24700) | comGD | 2557252..2557683 (-) | 432 | NP_390350.1 | membrane component of the DNA transport pilin platform | Machinery gene |
| BSU_24710 (BSU24710) | comGC | 2557673..2557969 (-) | 297 | NP_390351.1 | pilin-like component of the DNA transport membrane pilin platform | Machinery gene |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| sinR | degU | negative effect |
| degU | comK | positive effect |
| comK | comK | positive effect |
| comK | late competence genes | positive effect |
| codY | comK | negative effect |
| clpP | comK | negative effect |
| mecA | comK | negative effect |
| kre | comK | negative effect |
| abrB | comK | negative effect |
| comS | comK | positive effect |
| spo0A | comK | positive effect |
| rok | comK | negative effect |
| clpC | comK | negative effect |
| med | comK | positive effect |
| spo0A | comK | negative effect |
| comK | late competence genes | positive effect |
| clpP | degU | negative effect |
| abrB | rok | negative effect |
| spo0A | abrB | negative effect |
| comA | comS | positive effect |
| spo0A | rok | negative effect |
| ylbF | spo0A | positive effect |
| ymcA | spo0A | positive effect |
| sinR | spo0A | negative effect |
| yaaT | spo0A | positive effect |
| sinR | rok | negative effect |
| degQ | degU | positive effect |
| clpC | degU | negative effect |
| degS | degU | positive effect |
| rapC | comA | negative effect |
| rapF | comA | negative effect |
| comP | comA | positive effect |
| sinI | sinR | negative effect |
| phrC | rapC | negative effect |
| phrF | rapF | negative effect |
| comX | comP | positive effect |
| comQ | comX | positive effect |
Sequence
Protein
Download Length: 111 a.a. Molecular weight: 12988.64 Da Isoelectric Point: 7.2023
MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVSAVLDVSVHTLLDEKHETEYDGQLDSEWEK
LVRDAMTSGVSKKQFREFLDYQKWRKSQKEE
Nucleotide
Download Length: 336 bp
TTGATTGGCCAGCGTATTAAACAATACCGTAAAGAAAAAGGCTACTCACTATCAGAACTAGCTGAAAAAGCTGGGGTAGC
GAAGTCTTATTTAAGCTCAATAGAACGAAATCTACAAACGAACCCCTCCATTCAATTTCTCGAAAAAGTCTCCGCTGTTC
TGGACGTCTCGGTTCATACTTTGCTCGATGAGAAACATGAAACCGAATACGATGGTCAATTAGATAGTGAATGGGAGAAA
TTGGTTCGCGATGCGATGACATCCGGGGTATCGAAAAAACAATTTCGTGAATTTTTAGATTATCAAAAATGGAGAAAATC
CCAAAAAGAGGAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
References
| [1] | Usha Kantiwal et al. (2023) Efficient Inhibition of Bacterial Biofilm Through Interference of Protein-Protein Interaction of Master Regulator Proteins: a Proof of Concept Study with SinR- SinI Complex of Bacillus subtilis. Applied Biochemistry And Biotechnology 195(3):1947-1967. [PMID: 36401726] |
| [2] | Jan Kampf et al. (2018) Selective Pressure for Biofilm Formation in Bacillus subtilis: Differential Effect of Mutations in the Master Regulator SinR on Bistability. MBio 9(5):e01464-18. [PMID: 30181249] |
| [3] | Mitsuo Ogura et al. (2014) Regulation of the response regulator gene degU through the binding of SinR/SlrR and exclusion of SinR/SlrR by DegU in Bacillus subtilis. Journal of Bacteriology 196(4):873-81. [PMID: 24317403] |
| [4] | Vicki L Colledge et al. (2011) Structure and organisation of SinR, the master regulator of biofilm formation in Bacillus subtilis. Journal of Molecular Biology 411(3):597-613. [PMID: 21708175] |
| [5] | Tran Thu Hoa et al. (2002) Rok (YkuW) regulates genetic competence in Bacillus subtilis by directly repressing comK. Molecular Microbiology 43(1):15-26. [PMID: 11849533] |
| [6] | R J Lewis et al. (1996) Crystallisation of the Bacillus subtilis sporulation inhibitor SinR, complexed with its antagonist, SinI. FEBS Letters 378(1):98-100. [PMID: 8549812] |
| [7] | L Liu et al. (1996) Plasmid-amplified comS enhances genetic competence and suppresses sinR in Bacillus subtilis. Journal of Bacteriology 178(17):5144-52. [PMID: 8752331] |
| [8] | I Mandic-Mulec et al. (1995) The Bacillus subtilis SinR protein is a repressor of the key sporulation gene spo0A. Journal of Bacteriology 177(16):4619-27. [PMID: 7642487] |
| [9] | U Bai et al. (1993) SinI modulates the activity of SinR, a developmental switch protein of Bacillus subtilis, by protein-protein interaction. Genes & Development 7(1):139-48. [PMID: 8422983] |