Detailed information    

experimental Experimentally validated

Overview

Name   sinR   Type   Regulator
Locus tag   BSU_24610 Genome accession   NC_000964
Coordinates   2552653..2552988 (+) Length   111 a.a.
NCBI ID   NP_390341.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   repression of rok; repression of degU; repression of spo0A   
Competence regulation

Function

In Bacillus subtilis, the sinR gene encodes a pleiotropic DNA-binding protein that acts as a key regulator of multiple developmental processes, including competence development and sporulation. SinR is known to repress the expression of the spo0A gene, which is essential for initiating sporulation and competence. By repressing spo0A, SinR indirectly affects the expression of comK, the master regulator of competence, thereby influencing the natural transformation process. Studies have also shown that SinR can repress the expression of the gene degU and rok.


Genomic Context

Location: 2547653..2557988
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_24570 (BSU24570) gcvT 2548245..2549333 (-) 1089 NP_390337.2 aminomethyltransferase (glycine cleavage system protein T) -
  BSU_24580 (BSU24580) yqhH 2549775..2551448 (+) 1674 NP_390338.1 putative RNA polymerase-associated helicase protein -
  BSU_24590 (BSU24590) yqhG 2551469..2552263 (+) 795 NP_390339.1 hypothetical protein -
  BSU_24600 (BSU24600) sinI 2552446..2552619 (+) 174 NP_390340.1 antagonist of SinR Regulator
  BSU_24610 (BSU24610) sinR 2552653..2552988 (+) 336 NP_390341.1 master regulator of biofilm formation Regulator
  BSU_24620 (BSU24620) tasA 2553081..2553866 (-) 786 NP_390342.1 major biofilm matrix component -
  BSU_24630 (BSU24630) sipW 2553930..2554502 (-) 573 NP_390343.1 type I signal peptidase -
  BSU_24640 (BSU24640) tapA 2554486..2555247 (-) 762 NP_390344.1 lipoprotein for biofilm formation -
  BSU_24650 (BSU24650) yqzG 2555519..2555845 (+) 327 NP_390345.1 hypothetical protein -
  BSU_24660 (BSU24660) spoIIT 2555887..2556066 (-) 180 NP_390346.2 factor involved in sporulation -
  BSU_24670 (BSU24670) comGG 2556137..2556511 (-) 375 NP_390347.1 component of the DNA transport pilin platform Machinery gene
  BSU_24680 (BSU24680) comGF 2556512..2556895 (-) 384 NP_390348.1 component of the DNA transport pilin platform Machinery gene
  BSU_24690 (BSU24690) comGE 2556921..2557268 (-) 348 NP_390349.1 component of the DNA transport pilin platform Machinery gene
  BSU_24700 (BSU24700) comGD 2557252..2557683 (-) 432 NP_390350.1 membrane component of the DNA transport pilin platform Machinery gene
  BSU_24710 (BSU24710) comGC 2557673..2557969 (-) 297 NP_390351.1 pilin-like component of the DNA transport membrane pilin platform Machinery gene

Regulatory network

Positive effect      
Negative effect
Regulator Target Regulation
  sinR degU negative effect
  degU comK positive effect
  comK comK positive effect
  comK late competence genes positive effect
  codY comK negative effect
  clpP comK negative effect
  mecA comK negative effect
  kre comK negative effect
  abrB comK negative effect
  comS comK positive effect
  spo0A comK positive effect
  rok comK negative effect
  clpC comK negative effect
  med comK positive effect
  spo0A comK negative effect
  comK late competence genes positive effect
  clpP degU negative effect
  abrB rok negative effect
  spo0A abrB negative effect
  comA comS positive effect
  spo0A rok negative effect
  sinR spo0A negative effect
  sinR rok negative effect
  degQ degU positive effect
  clpC degU negative effect
  degS degU positive effect
  rapC comA negative effect
  rapF comA negative effect
  comP comA positive effect
  sinI sinR negative effect
  phrC rapC negative effect
  phrF rapF negative effect
  comX comP positive effect
  comQ comX positive effect

Sequence

Protein


Download         Length: 111 a.a.        Molecular weight: 12988.64 Da        Isoelectric Point: 7.2023

>NTDB_id=81 BSU_24610 NP_390341.1 2552653..2552988(+) (sinR) [Bacillus subtilis subsp. subtilis str. 168]
MIGQRIKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVSAVLDVSVHTLLDEKHETEYDGQLDSEWEK
LVRDAMTSGVSKKQFREFLDYQKWRKSQKEE

Nucleotide


Download         Length: 336 bp        

>NTDB_id=81 BSU_24610 NP_390341.1 2552653..2552988(+) (sinR) [Bacillus subtilis subsp. subtilis str. 168]
TTGATTGGCCAGCGTATTAAACAATACCGTAAAGAAAAAGGCTACTCACTATCAGAACTAGCTGAAAAAGCTGGGGTAGC
GAAGTCTTATTTAAGCTCAATAGAACGAAATCTACAAACGAACCCCTCCATTCAATTTCTCGAAAAAGTCTCCGCTGTTC
TGGACGTCTCGGTTCATACTTTGCTCGATGAGAAACATGAAACCGAATACGATGGTCAATTAGATAGTGAATGGGAGAAA
TTGGTTCGCGATGCGATGACATCCGGGGTATCGAAAAAACAATTTCGTGAATTTTTAGATTATCAAAAATGGAGAAAATC
CCAAAAAGAGGAGTAG

Domains

Predicted by InterproScan.

Helix-turn-helix (HTH_3)

(6-58)

Anti-repressor SinI (SinI)

(74-101)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References

[1] Usha Kantiwal et al. (2023) Efficient Inhibition of Bacterial Biofilm Through Interference of Protein-Protein Interaction of Master Regulator Proteins: a Proof of Concept Study with SinR- SinI Complex of Bacillus subtilis. Applied Biochemistry And Biotechnology 195(3):1947-1967. [PMID: 36401726]
[2] Jan Kampf et al. (2018) Selective Pressure for Biofilm Formation in Bacillus subtilis: Differential Effect of Mutations in the Master Regulator SinR on Bistability. MBio 9(5):e01464-18. [PMID: 30181249]
[3] Mitsuo Ogura et al. (2014) Regulation of the response regulator gene degU through the binding of SinR/SlrR and exclusion of SinR/SlrR by DegU in Bacillus subtilis. Journal of Bacteriology 196(4):873-81. [PMID: 24317403]
[4] Vicki L Colledge et al. (2011) Structure and organisation of SinR, the master regulator of biofilm formation in Bacillus subtilis. Journal of Molecular Biology 411(3):597-613. [PMID: 21708175]
[5] Tran Thu Hoa et al. (2002) Rok (YkuW) regulates genetic competence in Bacillus subtilis by directly repressing comK. Molecular Microbiology 43(1):15-26. [PMID: 11849533]
[6] R J Lewis et al. (1996) Crystallisation of the Bacillus subtilis sporulation inhibitor SinR, complexed with its antagonist, SinI. FEBS Letters 378(1):98-100. [PMID: 8549812]
[7] L Liu et al. (1996) Plasmid-amplified comS enhances genetic competence and suppresses sinR in Bacillus subtilis. Journal of Bacteriology 178(17):5144-52. [PMID: 8752331]
[8] I Mandic-Mulec et al. (1995) The Bacillus subtilis SinR protein is a repressor of the key sporulation gene spo0A. Journal of Bacteriology 177(16):4619-27. [PMID: 7642487]
[9] U Bai et al. (1993) SinI modulates the activity of SinR, a developmental switch protein of Bacillus subtilis, by protein-protein interaction. Genes & Development 7(1):139-48. [PMID: 8422983]