Detailed information    

experimental Experimentally validated

Overview

Name   comGD   Type   Machinery gene
Locus tag   BSU_24700 Genome accession   NC_000964
Coordinates   2557252..2557683 (-) Length   143 a.a.
NCBI ID   NP_390350.1    Uniprot ID   P25956
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus   
DNA binding and uptake

Function

The comGD gene is a component of the transformation pseudopilus machinery. ComGD is essential for the assembly and function of the pseudopilus, which binds to extracellular DNA and retracts to pull the DNA into the periplasmic space.


Genomic Context

Location: 2552252..2562683
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_24600 (BSU24600) sinI 2552446..2552619 (+) 174 NP_390340.1 antagonist of SinR Regulator
  BSU_24610 (BSU24610) sinR 2552653..2552988 (+) 336 NP_390341.1 master regulator of biofilm formation Regulator
  BSU_24620 (BSU24620) tasA 2553081..2553866 (-) 786 NP_390342.1 major biofilm matrix component -
  BSU_24630 (BSU24630) sipW 2553930..2554502 (-) 573 NP_390343.1 type I signal peptidase -
  BSU_24640 (BSU24640) tapA 2554486..2555247 (-) 762 NP_390344.1 lipoprotein for biofilm formation -
  BSU_24650 (BSU24650) yqzG 2555519..2555845 (+) 327 NP_390345.1 hypothetical protein -
  BSU_24660 (BSU24660) spoIIT 2555887..2556066 (-) 180 NP_390346.2 factor involved in sporulation -
  BSU_24670 (BSU24670) comGG 2556137..2556511 (-) 375 NP_390347.1 component of the DNA transport pilin platform Machinery gene
  BSU_24680 (BSU24680) comGF 2556512..2556895 (-) 384 NP_390348.1 component of the DNA transport pilin platform Machinery gene
  BSU_24690 (BSU24690) comGE 2556921..2557268 (-) 348 NP_390349.1 component of the DNA transport pilin platform Machinery gene
  BSU_24700 (BSU24700) comGD 2557252..2557683 (-) 432 NP_390350.1 membrane component of the DNA transport pilin platform Machinery gene
  BSU_24710 (BSU24710) comGC 2557673..2557969 (-) 297 NP_390351.1 pilin-like component of the DNA transport membrane pilin platform Machinery gene
  BSU_24720 (BSU24720) comGB 2557983..2558954 (-) 972 NP_390352.1 membrane pilin platform component of the DNA transport machinery Machinery gene
  BSU_24730 (BSU24730) comGA 2559007..2560077 (-) 1071 NP_390353.1 membrane associated ATPase of the pilin platform for DNA competence Machinery gene
  BSU_24740 (BSU24740) yqxL 2560489..2561442 (-) 954 NP_390354.1 CorA-type divalent ion transporter -

Regulatory network

Positive effect      
Negative effect
Regulator Target Regulation
  comZ comGD negative effect
  comZ comGB negative effect
  comZ comGA negative effect
  comZ comGF negative effect
  comZ comGG negative effect
  comZ comGC negative effect
  comC comGC positive effect
  comZ comGE negative effect

Sequence

Protein


Download         Length: 143 a.a.        Molecular weight: 16008.62 Da        Isoelectric Point: 10.0432

>NTDB_id=99 BSU_24700 NP_390350.1 2557252..2557683(-) (comGD) [Bacillus subtilis subsp. subtilis str. 168]
MNIKLNEEKGFTLLESLLVLSLASILLVAVFTTLPPAYDNTAVRQAASQLKNDIMLTQQTAISRQQRTKILFHKKEYQLV
IGDTVIERPYATGLSIELLTLKDRLEFNEKGHPNAGGKIRVKGHAVYDITVYLGSGRVNVERK

Nucleotide


Download         Length: 432 bp        

>NTDB_id=99 BSU_24700 NP_390350.1 2557252..2557683(-) (comGD) [Bacillus subtilis subsp. subtilis str. 168]
TTGAACATTAAATTAAACGAGGAGAAGGGGTTTACCCTTTTAGAAAGTTTGCTTGTGTTAAGCCTTGCCTCTATCCTCCT
GGTGGCCGTCTTCACTACACTTCCTCCTGCTTATGACAATACAGCTGTCCGACAGGCAGCAAGTCAGCTGAAAAATGATA
TTATGCTCACACAGCAGACTGCTATTTCCCGTCAACAAAGAACAAAAATTCTCTTTCATAAAAAAGAATATCAATTAGTC
ATTGGTGATACGGTTATTGAACGTCCGTATGCAACGGGACTTTCTATAGAACTGCTGACATTAAAAGACCGTTTGGAATT
TAATGAGAAAGGGCACCCGAATGCAGGCGGAAAAATACGAGTAAAAGGCCATGCCGTTTATGACATAACAGTTTATCTAG
GGAGCGGGAGAGTCAATGTGGAGAGAAAATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(8-31)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P25956

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References

[1] Gürol M Süel et al. (2006) An excitable gene regulatory circuit induces transient cellular differentiation. Nature 440(7083):545-50. [PMID: 16554821]
[2] Inês Chen et al. (2006) A macromolecular complex formed by a pilin-like protein in competent Bacillus subtilis. The Journal of Biological Chemistry 281(31):21720-21727. [PMID: 16751195]
[3] Y S Chung et al. (1998) All seven comG open reading frames are required for DNA binding during transformation of competent Bacillus subtilis. Journal of Bacteriology 180(1):41-5. [PMID: 9422590]
[4] Y S Chung et al. (1998) Cell surface localization and processing of the ComG proteins, required for DNA binding during transformation of Bacillus subtilis. Molecular Microbiology 29(3):905-13. [PMID: 9723928]
[5] D van Sinderen et al. (1995) comK encodes the competence transcription factor, the key regulatory protein for competence development in Bacillus subtilis. Molecular Microbiology 15(3):455-62. [PMID: 7783616]