Detailed information    

experimental Experimentally validated

Overview


Name   comZ   Type   Regulator
Locus tag   BSU_11310 Genome accession   NC_000964
Coordinates   1207597..1207788 (+) Length   63 a.a.
NCBI ID   NP_389013.1    Uniprot ID   O32437
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   repression of comG operon   
Competence regulation

Function


Disruption of comZ (yjzA) caused a five-fold enhancement of comG expression, thereby leading to a three-fold-higher transformation efficiency. The expression of comK and the other three late competence operons was not affected significantly in the yjzA-deficient mutant.


Genomic Context


Location: 1202597..1212788
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_11250 (BSU11250) argF 1203461..1204420 (+) 960 NP_389007.1 ornithine carbamoyltransferase -
  BSU_11260 (BSU11260) yjzC 1204506..1204685 (+) 180 NP_389008.1 hypothetical protein -
  BSU_11270 (BSU11270) yjzD 1204731..1204916 (-) 186 NP_389009.1 forespore targeted protein -
  BSU_11280 (BSU11280) yjaU 1205165..1205899 (+) 735 NP_389010.1 hypothetical protein -
  BSU_11290 (BSU11290) yjaV 1205981..1206538 (+) 558 NP_389011.2 putative NAD(P) binding enzyme -
  BSU_11300 (BSU11300) med 1206629..1207582 (+) 954 NP_389012.2 positive regulator of comK Regulator
  BSU_11310 (BSU11310) comZ 1207597..1207788 (+) 192 NP_389013.1 putative late competence gene Regulator
  BSU_11320 (BSU11320) yjzB 1207818..1208057 (-) 240 NP_389014.1 spore coat protein -
  BSU_11330 (BSU11330) fabHA 1208222..1209160 (+) 939 NP_389015.1 beta-ketoacyl-acyl carrier protein synthase III 1 -
  BSU_11340 (BSU11340) fabF 1209183..1210424 (+) 1242 NP_389016.1 beta-ketoacyl-acyl carrier protein synthase II (involved in pimelate synthesis) -
  BSU_11350 (BSU11350) yjaZ 1210500..1211285 (+) 786 NP_389017.1 hypothetical protein -
  BSU_11360 (BSU11360) appD 1211477..1212463 (+) 987 NP_389018.1 oligopeptide ABC transporter (ATP-binding protein) -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  comZ comGB negative effect
  comZ comGA negative effect
  comZ comGF negative effect
  comZ comGG negative effect
  comZ comGC negative effect
  comZ comGE negative effect
  comZ comGD negative effect
  comC comGC positive effect

Sequence


Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=149 BSU_11310 NP_389013.1 1207597..1207788(+) (comZ) [Bacillus subtilis subsp. subtilis str. 168]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=149 BSU_11310 NP_389013.1 1207597..1207788(+) (comZ) [Bacillus subtilis subsp. subtilis str. 168]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains


Predicted by InterProScan.

(4-58)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB O32437

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] M Ogura et al. (2000) Bacillus subtilis comZ (yjzA) negatively affects expression of comG but not comK. Journal of Bacteriology 182(17):4992-4. [PMID: 10940045]