Detailed information    

experimental Experimentally validated

Overview


Name   comC   Type   Machinery gene
Locus tag   BSU_28070 Genome accession   NC_000964
Coordinates   2864426..2865172 (-) Length   248 a.a.
NCBI ID   NP_390685.2    Uniprot ID   P15378
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   processing and translocation of ComGC; assembly of the pseudopilus   
DNA binding and uptake

Function


In the natural transformation process of Bacillus subtilis, the comC gene encodes a prepilin peptidase that is essential for processing and translocating ComGC, a pilin-like protein required for DNA binding and uptake. ComC functions as a processing enzyme that cleaves the N-terminal domain of ComGC, allowing it to be correctly translocated to the outer face of the cell membrane. This processing step is crucial for the assembly of the transformation pilus, which facilitates the binding and retraction of transforming DNA across the cell wall. Without ComC, the ComGC protein cannot be properly processed or translocated, resulting in an inability to bind and uptake DNA efficiently.


Genomic Context


Location: 2859426..2870172
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_28020 (BSU28020) mreC 2859832..2860704 (-) 873 NP_390680.2 cell-shape determining protein -
  BSU_28030 (BSU28030) mreB 2860735..2861748 (-) 1014 NP_390681.2 cell-shape determining protein -
  BSU_28040 (BSU28040) ysxA/radC 2861840..2862535 (-) 696 NP_390682.1 conserved nucleotide-related metabolism protein Machinery gene
  BSU_28050 (BSU28050) maf 2862572..2863141 (-) 570 NP_390683.1 nucleoside triphosphate pyrophosphatase; septum formation DNA-binding protein (multicopy associated filamentation) -
  BSU_28060 (BSU28060) spoIIB 2863294..2864292 (-) 999 NP_390684.1 spatial and temporal regulator of the dissolution of septal peptidoglycan during engulfment (stage II sporulation) -
  BSU_28070 (BSU28070) comC 2864426..2865172 (-) 747 NP_390685.2 membrane prepilin peptidase Machinery gene
  BSU_28080 (BSU28080) folC 2865312..2866604 (-) 1293 NP_390686.1 folyl-polyglutamate synthase -
  BSU_28090 (BSU28090) valS 2866664..2869306 (-) 2643 NP_390687.2 valyl-tRNA synthetase -
  BSU_28099 (BSU28099) yszA 2869754..2869945 (+) 192 YP_003097770.1 hypothetical protein -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  comC comGC positive effect
  comZ comGC negative effect
  comZ comGB negative effect
  comZ comGA negative effect
  comZ comGF negative effect
  comZ comGG negative effect
  comZ comGE negative effect
  comZ comGD negative effect

Sequence


Protein


Download         Length: 248 a.a.        Molecular weight: 26435.04 Da        Isoelectric Point: 9.7944

>NTDB_id=103 BSU_28070 NP_390685.2 2864426..2865172(-) (comC) [Bacillus subtilis subsp. subtilis str. 168]
MLSILFIFGLILGSFYYTAGCRIPLHLSIIAPRSSCPFCRRTLTPAELIPILSFLFQKGKCKSCGHRISFMYPAAELVTA
CLFAAAGIRFGISLELFPAVVFISLLIIVAVTDIHFMLIPNRILIFFLPFLAAARLISPLDSWYAGLLGAAAGFLFLAVI
AAITHGGVGGGDIKLFAVIGFVLGVKMLAAAFFFSVLIGALYGAAAVLTGRLAKRQPLPFAPAIAAGSILAYLYGDSIIS
FYIKMALG

Nucleotide


Download         Length: 747 bp        

>NTDB_id=103 BSU_28070 NP_390685.2 2864426..2865172(-) (comC) [Bacillus subtilis subsp. subtilis str. 168]
ATGCTATCCATTCTTTTTATCTTCGGGCTTATCCTTGGTTCTTTTTACTATACGGCCGGGTGCCGTATCCCCTTACATCT
ATCTATTATTGCGCCCCGTTCATCATGCCCGTTTTGCCGGCGAACATTAACTCCTGCAGAATTAATTCCCATCCTGTCAT
TCCTATTTCAAAAAGGTAAATGTAAAAGCTGCGGGCATAGGATTTCTTTTATGTATCCCGCAGCAGAGCTTGTGACAGCG
TGTTTATTTGCCGCCGCAGGAATACGCTTTGGCATATCGCTGGAACTGTTTCCCGCTGTGGTGTTTATCTCTCTTCTCAT
TATTGTTGCAGTGACAGATATTCATTTTATGCTGATTCCAAATCGAATATTGATTTTCTTTCTTCCCTTTTTGGCGGCCG
CGAGATTGATTTCTCCGCTTGATTCCTGGTATGCAGGCCTGTTAGGTGCGGCAGCCGGATTTTTGTTTCTGGCTGTAATT
GCCGCAATCACCCATGGGGGAGTAGGGGGAGGAGATATTAAATTATTTGCGGTGATTGGCTTTGTGCTTGGTGTGAAAAT
GCTGGCAGCTGCCTTTTTCTTTTCAGTTTTGATAGGTGCATTATATGGAGCGGCAGCTGTTCTGACTGGTAGACTCGCTA
AAAGGCAGCCGCTTCCCTTCGCCCCCGCTATAGCCGCAGGGAGCATTTTAGCCTATTTATACGGTGACTCTATCATTTCT
TTTTATATCAAAATGGCATTGGGCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P15378

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] Inês Chen et al. (2006) A macromolecular complex formed by a pilin-like protein in competent Bacillus subtilis. The Journal of Biological Chemistry 281(31):21720-21727. [PMID: 16751195]
[2] Y S Chung et al. (1998) Cell surface localization and processing of the ComG proteins, required for DNA binding during transformation of Bacillus subtilis. Molecular Microbiology 29(3):905-13. [PMID: 9723928]
[3] Y S Chung et al. (1995) ComC is required for the processing and translocation of comGC, a pilin-like competence protein of Bacillus subtilis. Molecular Microbiology 15(3):543-51. [PMID: 7783624]
[4] S Mohan et al. (1990) Transcriptional regulation of comC: evidence for a competence-specific transcription factor in Bacillus subtilis. Journal of Bacteriology 172(7):4064-71. [PMID: 1694528]
[5] S Mohan et al. (1989) Molecular cloning and characterization of comC, a late competence gene of Bacillus subtilis. Journal of Bacteriology 171(11):6043-51. [PMID: 2553669]