Detailed information NTG0000096

Experimentally validated

Overview

• Name: comGA
• Type: Machinery gene
• Locus tag: BSU_24730
• Genome accession: NC_000964
• Coordinates: 2559007..2560077 (-)
• Length: 356 a.a.
• NCBI ID: NP_390353.1
• Uniprot ID: -
• Organism: Bacillus subtilis subsp. subtilis str. 168
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus DNA binding and uptake

Function

The comGA gene is essential for the initial binding of transforming DNA to the cell surface and for the assembly of the pseudopilus, a structure required for DNA uptake.

Genomic Context

Location: 2554007..2565077

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BSU_24640 (BSU24640)	tapA	2554486..2555247 (-)	762	NP_390344.1	lipoprotein for biofilm formation	-
BSU_24650 (BSU24650)	yqzG	2555519..2555845 (+)	327	NP_390345.1	hypothetical protein	-
BSU_24660 (BSU24660)	spoIIT	2555887..2556066 (-)	180	NP_390346.2	factor involved in sporulation	-
BSU_24670 (BSU24670)	comGG	2556137..2556511 (-)	375	NP_390347.1	component of the DNA transport pilin platform	Machinery gene
BSU_24680 (BSU24680)	comGF	2556512..2556895 (-)	384	NP_390348.1	component of the DNA transport pilin platform	Machinery gene
BSU_24690 (BSU24690)	comGE	2556921..2557268 (-)	348	NP_390349.1	component of the DNA transport pilin platform	Machinery gene
BSU_24700 (BSU24700)	comGD	2557252..2557683 (-)	432	NP_390350.1	membrane component of the DNA transport pilin platform	Machinery gene
BSU_24710 (BSU24710)	comGC	2557673..2557969 (-)	297	NP_390351.1	pilin-like component of the DNA transport membrane pilin platform	Machinery gene
BSU_24720 (BSU24720)	comGB	2557983..2558954 (-)	972	NP_390352.1	membrane pilin platform component of the DNA transport machinery	Machinery gene
BSU_24730 (BSU24730)	comGA	2559007..2560077 (-)	1071	NP_390353.1	membrane associated ATPase of the pilin platform for DNA competence	Machinery gene
BSU_24740 (BSU24740)	yqxL	2560489..2561442 (-)	954	NP_390354.1	CorA-type divalent ion transporter	-
BSU_24750 (BSU24750)	yqhB	2561585..2562913 (+)	1329	NP_390355.1	putative membrane associated enzyme	-
BSU_24760 (BSU24760)	rsbRD	2562966..2563802 (-)	837	NP_390356.2	component of the anxiosome (stressosome)	-
BSU_24770 (BSU24770)	mgsR	2564026..2564406 (-)	381	NP_390357.2	transcriptional regulator of stress	-
BSU_24780 (BSU24780)	yqgY	2564638..2564883 (+)	246	NP_390358.1	hypothetical protein	-

Regulatory network

Positive effect      

Negative effect

Regulator	Target	Regulation
comZ	comGA	negative effect
comZ	comGB	negative effect
comZ	comGF	negative effect
comZ	comGG	negative effect
comZ	comGC	negative effect
comC	comGC	positive effect
comZ	comGE	negative effect
comZ	comGD	negative effect

Sequence

Protein

• Length: 356 a.a.
• Molecular weight: 40458.64 Da
• Isoelectric Point: 9.0175

>NTDB_id=96 BSU_24730 NP_390353.1 2559007..2560077(-) (comGA) [Bacillus subtilis subsp. subtilis str. 168]
MDSIEKVSKNLIEEAYLTKASDIHIVPRERDAIIHFRVDHALLKKRDMKKEECVRLISHFKFLSAMDIGERRKPQNGSLT
LKLKEGNVHLRMSTLPTINEESLVIRVMPQYNIPSIDKLSLFPKTGATLLSFLKHSHGMLIFTGPTGSGKTTTLYSLVQY
AKKHFNRNIVTLEDPVETRDEDVLQVQVNEKAGVTYSAGLKAILRHDPDMIILGEIRDAETAEIAVRAAMTGHLVLTSLH
TRDAKGAIYRLLEFGINMNEIEQTVIAIAAQRLVDLACPFCENGCSSVYCRQSRNTRRASVYELLYGKNLQQCIQEAKGN
HANYQYQTLRQIIRKGIALGYLTTNNYDRWVYHEKD

Nucleotide

• Length: 1071 bp

>NTDB_id=96 BSU_24730 NP_390353.1 2559007..2560077(-) (comGA) [Bacillus subtilis subsp. subtilis str. 168]
TTGGATTCAATAGAAAAGGTAAGCAAAAACTTGATTGAAGAGGCATATCTAACAAAGGCTTCTGATATTCACATTGTGCC
GAGGGAGCGGGACGCTATCATTCATTTTCGGGTCGATCATGCCTTGCTGAAAAAAAGGGACATGAAAAAAGAAGAGTGCG
TAAGACTGATTTCACATTTTAAATTTCTTTCAGCAATGGATATAGGTGAAAGGCGAAAGCCGCAAAACGGTTCGCTTACG
TTAAAGTTGAAAGAGGGAAATGTTCATTTAAGAATGTCAACGCTGCCCACAATTAATGAAGAAAGCCTCGTGATCAGAGT
GATGCCCCAATACAATATCCCTTCGATTGATAAATTGTCGCTATTTCCGAAGACAGGAGCCACATTACTCTCGTTTTTAA
AACATTCCCATGGCATGCTCATTTTTACCGGGCCGACTGGTTCAGGGAAGACTACCACATTATACTCTCTCGTTCAATAT
GCAAAAAAACACTTTAATCGAAATATTGTCACATTAGAGGACCCTGTTGAAACAAGGGACGAAGATGTTCTTCAGGTTCA
GGTGAATGAAAAAGCCGGTGTAACTTATTCCGCAGGTCTGAAAGCAATTTTGCGCCATGACCCCGATATGATTATTTTAG
GTGAGATCAGAGACGCGGAAACAGCTGAAATTGCGGTGCGGGCAGCGATGACGGGACATCTGGTACTAACGAGCCTTCAT
ACGAGAGACGCAAAGGGCGCAATTTACAGACTGCTTGAATTCGGTATCAATATGAATGAAATCGAACAGACTGTCATTGC
AATAGCGGCTCAGCGCTTGGTTGATTTGGCTTGCCCGTTTTGTGAAAACGGATGTTCATCAGTGTATTGCCGACAGTCAC
GAAATACTAGGAGAGCTAGCGTTTATGAGCTTCTATACGGGAAAAATCTTCAGCAATGTATCCAGGAGGCAAAAGGAAAT
CATGCAAATTACCAATATCAAACGCTTCGTCAAATTATCAGAAAAGGAATTGCGCTCGGCTATTTAACGACAAACAACTA
TGACCGGTGGGTTTATCATGAAAAAGATTAG

Domains

Predicted by InterproScan.

• Type II/IV secretion system protein (T2SSE) (10-275)

References

• [1]: Marie Burghard-Schrod et al. (2020) The Bacillus subtilis dCMP deaminase ComEB acts as a dynamic polar localization factor for ComGA within the competence machinery. Molecular Microbiology 113(5):906-922. [PMID: 31954084]
• [2]: Jeanette Hahn et al. (2015) ComGA-RelA interaction and persistence in the Bacillus subtilis K-state. Molecular Microbiology 97(3):454-71. [PMID: 25899641]
• [3]: Kenneth Briley et al. (2011) Maf acts downstream of ComGA to arrest cell division in competent cells of B. subtilis. Molecular Microbiology 81(1):23-39. [PMID: 21564336]
• [4]: Kenneth Briley et al. (2011) The secretion ATPase ComGA is required for the binding and transport of transforming DNA. Molecular Microbiology 81(3):818-30. [PMID: 21707789]
• [5]: Gürol M Süel et al. (2006) An excitable gene regulatory circuit induces transient cellular differentiation. Nature 440(7083):545-50. [PMID: 16554821]
• [6]: Dawit Kidane et al. (2005) Intracellular protein and DNA dynamics in competent Bacillus subtilis cells. Cell 122(1):73-84. [PMID: 16009134]
• [7]: Y S Chung et al. (1998) All seven comG open reading frames are required for DNA binding during transformation of competent Bacillus subtilis. Journal of Bacteriology 180(1):41-5. [PMID: 9422590]
• [8]: Y S Chung et al. (1998) Cell surface localization and processing of the ComG proteins, required for DNA binding during transformation of Bacillus subtilis. Molecular Microbiology 29(3):905-13. [PMID: 9723928]
• [9]: D van Sinderen et al. (1995) comK encodes the competence transcription factor, the key regulatory protein for competence development in Bacillus subtilis. Molecular Microbiology 15(3):455-62. [PMID: 7783616]