Detailed information    

experimental Experimentally validated

Overview


Name   comGA   Type   Machinery gene
Locus tag   BSU_24730 Genome accession   NC_000964
Coordinates   2559007..2560077 (-) Length   356 a.a.
NCBI ID   NP_390353.1    Uniprot ID   P25953
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus   
DNA binding and uptake

Function


The comGA gene is essential for the initial binding of transforming DNA to the cell surface and for the assembly of the pseudopilus, a structure required for DNA uptake.


Genomic Context


Location: 2554007..2565077
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_24640 (BSU24640) tapA 2554486..2555247 (-) 762 NP_390344.1 lipoprotein for biofilm formation -
  BSU_24650 (BSU24650) yqzG 2555519..2555845 (+) 327 NP_390345.1 hypothetical protein -
  BSU_24660 (BSU24660) spoIIT 2555887..2556066 (-) 180 NP_390346.2 factor involved in sporulation -
  BSU_24670 (BSU24670) comGG 2556137..2556511 (-) 375 NP_390347.1 component of the DNA transport pilin platform Machinery gene
  BSU_24680 (BSU24680) comGF 2556512..2556895 (-) 384 NP_390348.1 component of the DNA transport pilin platform Machinery gene
  BSU_24690 (BSU24690) comGE 2556921..2557268 (-) 348 NP_390349.1 component of the DNA transport pilin platform Machinery gene
  BSU_24700 (BSU24700) comGD 2557252..2557683 (-) 432 NP_390350.1 membrane component of the DNA transport pilin platform Machinery gene
  BSU_24710 (BSU24710) comGC 2557673..2557969 (-) 297 NP_390351.1 pilin-like component of the DNA transport membrane pilin platform Machinery gene
  BSU_24720 (BSU24720) comGB 2557983..2558954 (-) 972 NP_390352.1 membrane pilin platform component of the DNA transport machinery Machinery gene
  BSU_24730 (BSU24730) comGA 2559007..2560077 (-) 1071 NP_390353.1 membrane associated ATPase of the pilin platform for DNA competence Machinery gene
  BSU_24740 (BSU24740) yqxL 2560489..2561442 (-) 954 NP_390354.1 CorA-type divalent ion transporter -
  BSU_24750 (BSU24750) yqhB 2561585..2562913 (+) 1329 NP_390355.1 putative membrane associated enzyme -
  BSU_24760 (BSU24760) rsbRD 2562966..2563802 (-) 837 NP_390356.2 component of the anxiosome (stressosome) -
  BSU_24770 (BSU24770) mgsR 2564026..2564406 (-) 381 NP_390357.2 transcriptional regulator of stress -
  BSU_24780 (BSU24780) yqgY 2564638..2564883 (+) 246 NP_390358.1 hypothetical protein -

Regulatory network


Positive effect      
Negative effect
Regulator Target Regulation
  comZ comGA negative effect
  comZ comGB negative effect
  comZ comGF negative effect
  comZ comGG negative effect
  comZ comGC negative effect
  comC comGC positive effect
  comZ comGE negative effect
  comZ comGD negative effect

Sequence


Protein


Download         Length: 356 a.a.        Molecular weight: 40458.64 Da        Isoelectric Point: 9.0175

>NTDB_id=96 BSU_24730 NP_390353.1 2559007..2560077(-) (comGA) [Bacillus subtilis subsp. subtilis str. 168]
MDSIEKVSKNLIEEAYLTKASDIHIVPRERDAIIHFRVDHALLKKRDMKKEECVRLISHFKFLSAMDIGERRKPQNGSLT
LKLKEGNVHLRMSTLPTINEESLVIRVMPQYNIPSIDKLSLFPKTGATLLSFLKHSHGMLIFTGPTGSGKTTTLYSLVQY
AKKHFNRNIVTLEDPVETRDEDVLQVQVNEKAGVTYSAGLKAILRHDPDMIILGEIRDAETAEIAVRAAMTGHLVLTSLH
TRDAKGAIYRLLEFGINMNEIEQTVIAIAAQRLVDLACPFCENGCSSVYCRQSRNTRRASVYELLYGKNLQQCIQEAKGN
HANYQYQTLRQIIRKGIALGYLTTNNYDRWVYHEKD

Nucleotide


Download         Length: 1071 bp        

>NTDB_id=96 BSU_24730 NP_390353.1 2559007..2560077(-) (comGA) [Bacillus subtilis subsp. subtilis str. 168]
TTGGATTCAATAGAAAAGGTAAGCAAAAACTTGATTGAAGAGGCATATCTAACAAAGGCTTCTGATATTCACATTGTGCC
GAGGGAGCGGGACGCTATCATTCATTTTCGGGTCGATCATGCCTTGCTGAAAAAAAGGGACATGAAAAAAGAAGAGTGCG
TAAGACTGATTTCACATTTTAAATTTCTTTCAGCAATGGATATAGGTGAAAGGCGAAAGCCGCAAAACGGTTCGCTTACG
TTAAAGTTGAAAGAGGGAAATGTTCATTTAAGAATGTCAACGCTGCCCACAATTAATGAAGAAAGCCTCGTGATCAGAGT
GATGCCCCAATACAATATCCCTTCGATTGATAAATTGTCGCTATTTCCGAAGACAGGAGCCACATTACTCTCGTTTTTAA
AACATTCCCATGGCATGCTCATTTTTACCGGGCCGACTGGTTCAGGGAAGACTACCACATTATACTCTCTCGTTCAATAT
GCAAAAAAACACTTTAATCGAAATATTGTCACATTAGAGGACCCTGTTGAAACAAGGGACGAAGATGTTCTTCAGGTTCA
GGTGAATGAAAAAGCCGGTGTAACTTATTCCGCAGGTCTGAAAGCAATTTTGCGCCATGACCCCGATATGATTATTTTAG
GTGAGATCAGAGACGCGGAAACAGCTGAAATTGCGGTGCGGGCAGCGATGACGGGACATCTGGTACTAACGAGCCTTCAT
ACGAGAGACGCAAAGGGCGCAATTTACAGACTGCTTGAATTCGGTATCAATATGAATGAAATCGAACAGACTGTCATTGC
AATAGCGGCTCAGCGCTTGGTTGATTTGGCTTGCCCGTTTTGTGAAAACGGATGTTCATCAGTGTATTGCCGACAGTCAC
GAAATACTAGGAGAGCTAGCGTTTATGAGCTTCTATACGGGAAAAATCTTCAGCAATGTATCCAGGAGGCAAAAGGAAAT
CATGCAAATTACCAATATCAAACGCTTCGTCAAATTATCAGAAAAGGAATTGCGCTCGGCTATTTAACGACAAACAACTA
TGACCGGTGGGTTTATCATGAAAAAGATTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P25953

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References


[1] Marie Burghard-Schrod et al. (2020) The Bacillus subtilis dCMP deaminase ComEB acts as a dynamic polar localization factor for ComGA within the competence machinery. Molecular Microbiology 113(5):906-922. [PMID: 31954084]
[2] Jeanette Hahn et al. (2015) ComGA-RelA interaction and persistence in the Bacillus subtilis K-state. Molecular Microbiology 97(3):454-71. [PMID: 25899641]
[3] Kenneth Briley et al. (2011) Maf acts downstream of ComGA to arrest cell division in competent cells of B. subtilis. Molecular Microbiology 81(1):23-39. [PMID: 21564336]
[4] Kenneth Briley et al. (2011) The secretion ATPase ComGA is required for the binding and transport of transforming DNA. Molecular Microbiology 81(3):818-30. [PMID: 21707789]
[5] Gürol M Süel et al. (2006) An excitable gene regulatory circuit induces transient cellular differentiation. Nature 440(7083):545-50. [PMID: 16554821]
[6] Dawit Kidane et al. (2005) Intracellular protein and DNA dynamics in competent Bacillus subtilis cells. Cell 122(1):73-84. [PMID: 16009134]
[7] Y S Chung et al. (1998) All seven comG open reading frames are required for DNA binding during transformation of competent Bacillus subtilis. Journal of Bacteriology 180(1):41-5. [PMID: 9422590]
[8] Y S Chung et al. (1998) Cell surface localization and processing of the ComG proteins, required for DNA binding during transformation of Bacillus subtilis. Molecular Microbiology 29(3):905-13. [PMID: 9723928]
[9] D van Sinderen et al. (1995) comK encodes the competence transcription factor, the key regulatory protein for competence development in Bacillus subtilis. Molecular Microbiology 15(3):455-62. [PMID: 7783616]