Detailed information
Overview
| Name | clpP | Type | Regulator |
| Locus tag | SpyM6JRS4_RS01695 | Genome accession | NZ_CP011414 |
| Coordinates | 325122..325712 (+) | Length | 196 a.a. |
| NCBI ID | WP_002985850.1 | Uniprot ID | A0A9X8T4H8 |
| Organism | Streptococcus pyogenes JRS4 | ||
| Function | degradation of ComX Competence regulation |
||
Function
We found that expression of the sigX gene in a clpP mutant strain resulted in greater accumulation of sigma(X) protein, which resulted in higher levels of transcription from the sigma(X)-dependent promoters cinA, smf, and cglA. In addition, a clpP mutant containing sigX only at its wild-type loci on the chromosome generated more transcription from the sigma(X)-dependent cinA promoter than did the wild-type parental strain.
Genomic Context
Location: 320122..330712
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SpyM6JRS4_RS01680 (SpyM6JRS4_01675) | - | 320935..322380 (-) | 1446 | WP_011184212.1 | UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--L- lysine ligase | - |
| SpyM6JRS4_RS01685 (SpyM6JRS4_01680) | - | 322468..324102 (+) | 1635 | WP_011184213.1 | polysaccharide biosynthesis protein | - |
| SpyM6JRS4_RS01690 (SpyM6JRS4_01685) | upp | 324269..324898 (+) | 630 | WP_002985854.1 | uracil phosphoribosyltransferase | - |
| SpyM6JRS4_RS01695 (SpyM6JRS4_01690) | clpP | 325122..325712 (+) | 591 | WP_002985850.1 | ATP-dependent Clp protease proteolytic subunit | Regulator |
| SpyM6JRS4_RS01700 (SpyM6JRS4_01695) | - | 326204..326479 (+) | 276 | WP_002985847.1 | YlbG family protein | - |
| SpyM6JRS4_RS01705 (SpyM6JRS4_01700) | tmk | 326728..327363 (+) | 636 | WP_011184214.1 | dTMP kinase | - |
| SpyM6JRS4_RS01710 (SpyM6JRS4_01705) | - | 327381..328256 (+) | 876 | WP_002985844.1 | DNA polymerase III subunit delta' | - |
| SpyM6JRS4_RS01715 (SpyM6JRS4_01710) | - | 328275..328514 (+) | 240 | WP_011017422.1 | hypothetical protein | - |
| SpyM6JRS4_RS01725 (SpyM6JRS4_01720) | yabA | 328918..329241 (+) | 324 | WP_002985838.1 | DNA replication initiation control protein YabA | - |
| SpyM6JRS4_RS01730 (SpyM6JRS4_01725) | rsmI | 329246..330109 (+) | 864 | WP_011184217.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| SpyM6JRS4_RS01735 (SpyM6JRS4_01730) | - | 330136..330528 (+) | 393 | WP_011184218.1 | DUF5684 domain-containing protein | - |
Regulatory network
| Regulator | Target | Regulation |
|---|---|---|
| clpP | comX/sigX/comX1/sigX1 | negative effect |
| comX/sigX/comX1/sigX1 | late competence genes | positive effect |
| comX/sigX/comX2/sigX2 | late competence genes | positive effect |
| comX/sigX/comX1/sigX1 | late competence genes | positive effect |
| comX/sigX/comX2/sigX2 | late competence genes | positive effect |
| clpP | comX/sigX/comX2/sigX2 | negative effect |
Sequence
Protein
Download Length: 196 a.a. Molecular weight: 21648.88 Da Isoelectric Point: 5.2834
MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQLLFLDAQDNTKDIYLYVNTPGGSVSAGLAIVDTMN
FIKADVQTIVMGMAASMGTVIASSGTKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRHRLEKILAQNAGK
TIKQIHKDAERDYWMSAEETLAYGFIDEIMENNELK
Nucleotide
Download Length: 591 bp
ATGATTCCTGTTGTTATTGAACAAACTAGCCGTGGAGAACGTTCTTATGACATTTATTCACGTTTATTAAAAGACCGTAT
TATCATGTTAACAGGGCCTGTCGAAGACAACATGGCCAACTCTGTCATAGCGCAGCTCTTATTCCTTGACGCGCAAGACA
ACACTAAAGATATCTACCTATATGTCAACACACCAGGTGGCTCTGTCTCAGCAGGCTTGGCTATTGTCGATACCATGAAC
TTTATCAAGGCCGATGTGCAAACTATTGTCATGGGTATGGCAGCTTCTATGGGGACAGTCATTGCTTCATCAGGAACAAA
AGGCAAACGCTTTATGTTACCAAATGCAGAGTATATGATCCACCAGCCAATGGGTGGCACAGGCGGTGGCACGCAACAAA
CGGATATGGCTATCGCAGCAGAACATCTCTTAAAAACACGTCACCGTTTAGAAAAAATCTTAGCGCAAAATGCTGGAAAA
ACGATTAAACAAATCCATAAAGATGCTGAGCGTGATTATTGGATGAGTGCTGAAGAAACCTTGGCTTACGGTTTCATTGA
TGAAATCATGGAAAACAACGAACTAAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| clpP | Streptococcus mutans UA159 |
90.816 |
100 |
0.908 |
| clpP | Streptococcus pneumoniae R6 |
90.769 |
99.49 |
0.903 |
| clpP | Streptococcus pneumoniae D39 |
90.769 |
99.49 |
0.903 |
| clpP | Streptococcus pneumoniae Rx1 |
90.769 |
99.49 |
0.903 |
| clpP | Streptococcus pneumoniae TIGR4 |
90.769 |
99.49 |
0.903 |
| clpP | Streptococcus thermophilus LMD-9 |
89.796 |
100 |
0.898 |
| clpP | Streptococcus thermophilus LMG 18311 |
89.796 |
100 |
0.898 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
86.224 |
100 |
0.862 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
85.714 |
100 |
0.857 |
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
57.143 |
100 |
0.571 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
56.995 |
98.469 |
0.561 |
Multiple sequence alignment
References
| [1] | Jason A Opdyke et al. (2003) Expression of the secondary sigma factor sigmaX in Streptococcus pyogenes is restricted at two levels. Journal of Bacteriology 185(15):4291-7. [PMID: 12867436] |