Detailed information NTG0616133

Bioinformatically predicted

Overview

• Name: pilV
• Type: Machinery gene
• Locus tag: LG309_RS15840
• Genome accession: NZ_CP085231
• Coordinates: 3399375..3399563 (+)
• Length: 62 a.a.
• NCBI ID: WP_312289656.1
• Uniprot ID: -
• Organism: Stutzerimonas chloritidismutans strain ADH2-893
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 3394375..3404563

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LG309_RS15820 (LG309_15795)	coaE	3394473..3395081 (-)	609	WP_003302803.1	dephospho-CoA kinase	-
LG309_RS15825 (LG309_15800)	pilD	3395213..3396082 (-)	870	WP_404395062.1	prepilin peptidase	Machinery gene
LG309_RS15830 (LG309_15805)	pilC	3396085..3397302 (-)	1218	WP_404395064.1	type II secretion system F family protein	Machinery gene
LG309_RS15835 (LG309_15810)	pilB	3397305..3399008 (-)	1704	WP_404395066.1	type IV-A pilus assembly ATPase PilB	Machinery gene
LG309_RS15840	pilV	3399375..3399563 (+)	189	WP_312289656.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
LG309_RS15845 (LG309_15820)	-	3399580..3400026 (+)	447	WP_404395068.1	hypothetical protein	-
LG309_RS15850 (LG309_15825)	-	3400291..3401100 (+)	810	WP_404395070.1	ABC transporter permease	-
LG309_RS15855 (LG309_15830)	-	3401102..3401932 (+)	831	WP_404395072.1	hypothetical protein	-
LG309_RS15860 (LG309_15835)	-	3401929..3402825 (+)	897	WP_404395074.1	ABC transporter ATP-binding protein	-

Sequence

Protein

• Length: 62 a.a.
• Molecular weight: 6764.25 Da
• Isoelectric Point: 10.6275

>NTDB_id=616133 LG309_RS15840 WP_312289656.1 3399375..3399563(+) (pilV) [Stutzerimonas chloritidismutans strain ADH2-893]
MKLLKKKQKGFTLIELMIVVAIIGILAAIAIPQFNEYRAKANDSTAKADTKNMITVISAAMI

Nucleotide

• Length: 189 bp

>NTDB_id=616133 LG309_RS15840 WP_312289656.1 3399375..3399563(+) (pilV) [Stutzerimonas chloritidismutans strain ADH2-893]
ATGAAACTTCTTAAGAAGAAGCAAAAAGGCTTTACCCTGATCGAGCTGATGATCGTGGTTGCAATCATCGGTATCCTGGC
TGCCATCGCAATTCCGCAGTTCAATGAATATCGTGCCAAGGCGAATGATTCCACTGCCAAAGCTGACACAAAGAATATGA
TCACCGTAATTTCTGCAGCGATGATCTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Pseudomonas aeruginosa PAK	58.929	90.323	0.532
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	52.632	91.935	0.484
comP	Acinetobacter baylyi ADP1	58.824	82.258	0.484
pilA	Vibrio cholerae strain A1552	71.429	67.742	0.484
pilA	Vibrio cholerae C6706	71.429	67.742	0.484
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	71.429	67.742	0.484
pilA	Acinetobacter nosocomialis M2	76.923	62.903	0.484
pilA2	Legionella pneumophila str. Paris	61.224	79.032	0.484
pilA2	Legionella pneumophila strain ERS1305867	61.224	79.032	0.484
pilA	Ralstonia pseudosolanacearum GMI1000	69.048	67.742	0.468
pilA	Vibrio parahaemolyticus RIMD 2210633	56.863	82.258	0.468
pilA/pilA1	Eikenella corrodens VA1	74.359	62.903	0.468
pilA	Acinetobacter baumannii strain A118	85.294	54.839	0.468
pilA	Vibrio campbellii strain DS40M4	75.676	59.677	0.452
pilA	Haemophilus influenzae Rd KW20	65.116	69.355	0.452
pilA	Haemophilus influenzae 86-028NP	62.791	69.355	0.435
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	62.791	69.355	0.435
pilA/pilAII	Pseudomonas stutzeri DSM 10701	55.102	79.032	0.435
pilE	Neisseria gonorrhoeae strain FA1090	66.667	62.903	0.419
pilE	Neisseria gonorrhoeae MS11	66.667	62.903	0.419
pilA/pilAI	Pseudomonas stutzeri DSM 10701	74.286	56.452	0.419
comF	Acinetobacter baylyi ADP1	59.524	67.742	0.403
pilA	Glaesserella parasuis strain SC1401	58.537	66.129	0.387
pilA/pilA1	Synechocystis sp. PCC 6803	54.545	70.968	0.387
pilX	Neisseria meningitidis 8013	60.526	61.29	0.371
pilL	Neisseria gonorrhoeae MS11	60.526	61.29	0.371
pilA/pilA4	Thermus thermophilus HB27	58.974	62.903	0.371