Detailed information NTG0475394

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: H7683_RS24590
• Genome accession: NZ_CP060288
• Coordinates: 3092261..3092446 (+)
• Length: 61 a.a.
• NCBI ID: WP_143501533.1
• Uniprot ID: -
• Organism: Pseudomonas mendocina strain CPS5
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 3087261..3097446

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
H7683_RS14410 (H7683_14405)	coaE	3087360..3087968 (-)	609	WP_209449215.1	dephospho-CoA kinase	-
H7683_RS14415 (H7683_14410)	pilD	3088238..3089104 (-)	867	WP_209449216.1	A24 family peptidase	Machinery gene
H7683_RS14420 (H7683_14415)	pilC	3089108..3090328 (-)	1221	WP_181563849.1	type II secretion system F family protein	Machinery gene
H7683_RS14425 (H7683_14420)	pilB	3090332..3092032 (-)	1701	WP_209451037.1	type IV-A pilus assembly ATPase PilB	Machinery gene
H7683_RS24590 (H7683_14425)	pilA	3092261..3092446 (+)	186	WP_143501533.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
H7683_RS14435 (H7683_14430)	-	3092464..3092892 (+)	429	WP_143501531.1	hypothetical protein	-
H7683_RS14440 (H7683_14435)	-	3093046..3093855 (+)	810	WP_244973822.1	hypothetical protein	-
H7683_RS14445 (H7683_14440)	-	3093917..3094699 (+)	783	WP_244973823.1	hypothetical protein	-
H7683_RS14450 (H7683_14445)	-	3094786..3095607 (+)	822	WP_244973824.1	ABC transporter ATP-binding protein	-
H7683_RS14455 (H7683_14450)	nadC	3095715..3096563 (-)	849	WP_209449217.1	carboxylating nicotinate-nucleotide diphosphorylase	-

Sequence

Protein

• Length: 61 a.a.
• Molecular weight: 6471.80 Da
• Isoelectric Point: 10.4849

>NTDB_id=475394 H7683_RS24590 WP_143501533.1 3092261..3092446(+) (pilA) [Pseudomonas mendocina strain CPS5]
MKSLKKQKGFTLIELMIVIAIIGILAAIAIPQFNDYRAKANDTSAVADAKNGITAIIAALK

Nucleotide

• Length: 186 bp

>NTDB_id=475394 H7683_RS24590 WP_143501533.1 3092261..3092446(+) (pilA) [Pseudomonas mendocina strain CPS5]
ATGAAGTCTCTGAAGAAACAGAAGGGTTTCACCCTGATCGAGTTGATGATCGTGATTGCAATTATCGGTATTCTCGCGGC
TATCGCGATTCCGCAGTTCAATGATTATCGTGCCAAGGCGAATGATACTTCAGCGGTAGCAGACGCCAAAAATGGCATTA
CAGCTATTATTGCGGCTCTGAAGTGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	53.425	100	0.639
pilA	Haemophilus influenzae Rd KW20	43.59	100	0.557
pilA	Haemophilus influenzae 86-028NP	43.59	100	0.557
pilA/pilA1	Eikenella corrodens VA1	74.419	70.492	0.525
pilA	Pseudomonas aeruginosa PAK	70.455	72.131	0.508
pilA	Vibrio parahaemolyticus RIMD 2210633	60	81.967	0.492
pilA	Ralstonia pseudosolanacearum GMI1000	57.692	85.246	0.492
pilA2	Legionella pneumophila strain ERS1305867	65.217	75.41	0.492
pilA2	Legionella pneumophila str. Paris	65.217	75.41	0.492
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	59.184	80.328	0.475
pilA	Acinetobacter baumannii strain A118	64.444	73.77	0.475
pilA/pilAI	Pseudomonas stutzeri DSM 10701	66.667	68.852	0.459
pilA	Acinetobacter nosocomialis M2	66.667	68.852	0.459
comP	Acinetobacter baylyi ADP1	75.676	60.656	0.459
pilA	Vibrio campbellii strain DS40M4	77.778	59.016	0.459
pilE	Neisseria gonorrhoeae MS11	67.5	65.574	0.443
pilE	Neisseria gonorrhoeae strain FA1090	67.5	65.574	0.443
pilA/pilAII	Pseudomonas stutzeri DSM 10701	55.102	80.328	0.443
pilA	Vibrio cholerae strain A1552	72.222	59.016	0.426
pilA	Vibrio cholerae C6706	72.222	59.016	0.426
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	72.222	59.016	0.426
pilA/pilA4	Thermus thermophilus HB27	62.5	65.574	0.41
pilA	Glaesserella parasuis strain SC1401	72.727	54.098	0.393
comF	Acinetobacter baylyi ADP1	60.526	62.295	0.377
pilE	Legionella pneumophila strain ERS1305867	41.509	86.885	0.361
pilE	Legionella pneumophila str. Paris	41.509	86.885	0.361