Detailed information
Bioinformatically predicted
Overview
| Name | pilV | Type | Machinery gene |
| Locus tag | HNE05_RS20545 | Genome accession | NZ_CP053697 |
| Coordinates | 960788..960973 (+) | Length | 61 a.a. |
| NCBI ID | WP_173203713.1 | Uniprot ID | A0A6M8FDY9 |
| Organism | Aquipseudomonas campi strain S1-A32-2 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 953016..964141 | 960788..960973 | within | 0 |
Gene organization within MGE regions
Location: 953016..964141
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HNE05_RS04325 (HNE05_01935) | - | 953016..953483 (+) | 468 | WP_173203699.1 | FAD/FMN-containing dehydrogenase | - |
| HNE05_RS04330 (HNE05_01940) | - | 953480..954169 (+) | 690 | WP_173203701.1 | energy-coupling factor ABC transporter permease | - |
| HNE05_RS04335 (HNE05_01945) | - | 954273..954488 (+) | 216 | WP_173211596.1 | hypothetical protein | - |
| HNE05_RS04340 (HNE05_01950) | - | 954631..955771 (+) | 1141 | Protein_853 | IS481 family transposase | - |
| HNE05_RS04345 (HNE05_01955) | yacG | 955945..956139 (-) | 195 | WP_173203703.1 | DNA gyrase inhibitor YacG | - |
| HNE05_RS04350 (HNE05_01960) | coaE | 956136..956747 (-) | 612 | WP_173203705.1 | dephospho-CoA kinase | - |
| HNE05_RS04355 (HNE05_01965) | pilD | 956748..957614 (-) | 867 | WP_173203707.1 | prepilin peptidase | Machinery gene |
| HNE05_RS04360 (HNE05_01970) | pilC | 957618..958838 (-) | 1221 | WP_173203709.1 | type II secretion system F family protein | Machinery gene |
| HNE05_RS04365 (HNE05_01975) | pilB | 958842..960551 (-) | 1710 | WP_173203711.1 | type IV-A pilus assembly ATPase PilB | Machinery gene |
| HNE05_RS20545 (HNE05_01980) | pilV | 960788..960973 (+) | 186 | WP_173203713.1 | prepilin-type N-terminal cleavage/methylation domain-containing protein | Machinery gene |
| HNE05_RS04375 (HNE05_01985) | - | 960990..961445 (+) | 456 | WP_173203716.1 | hypothetical protein | - |
| HNE05_RS04380 (HNE05_01990) | - | 961591..962379 (+) | 789 | WP_240008815.1 | hypothetical protein | - |
| HNE05_RS04385 (HNE05_01995) | - | 962382..963221 (+) | 840 | WP_173203718.1 | hypothetical protein | - |
| HNE05_RS04390 (HNE05_02000) | - | 963221..964141 (+) | 921 | WP_173203720.1 | ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 61 a.a. Molecular weight: 6562.73 Da Isoelectric Point: 9.9318
>NTDB_id=446405 HNE05_RS20545 WP_173203713.1 960788..960973(+) (pilV) [Aquipseudomonas campi strain S1-A32-2]
MKSLKQQKGFTLIELMIVIAIIGILAAIAIPQFNEYRAKANDSTALADAKNNTTAIVSSLQ
MKSLKQQKGFTLIELMIVIAIIGILAAIAIPQFNEYRAKANDSTALADAKNNTTAIVSSLQ
Nucleotide
Download Length: 186 bp
>NTDB_id=446405 HNE05_RS20545 WP_173203713.1 960788..960973(+) (pilV) [Aquipseudomonas campi strain S1-A32-2]
ATGAAGTCTCTCAAGCAACAAAAAGGCTTTACCCTGATCGAGCTGATGATCGTAATCGCGATCATCGGTATTCTCGCCGC
AATTGCTATTCCGCAGTTCAATGAATATCGTGCTAAGGCGAATGATTCAACTGCCTTGGCCGATGCTAAGAATAACACTA
CGGCTATCGTATCCTCGCTTCAATAA
ATGAAGTCTCTCAAGCAACAAAAAGGCTTTACCCTGATCGAGCTGATGATCGTAATCGCGATCATCGGTATTCTCGCCGC
AATTGCTATTCCGCAGTTCAATGAATATCGTGCTAAGGCGAATGATTCAACTGCCTTGGCCGATGCTAAGAATAACACTA
CGGCTATCGTATCCTCGCTTCAATAA
Similar proteins
Only experimentally validated proteins are listed.