Detailed information NTG0421179

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: GYM54_RS21890
• Genome accession: NZ_CP048411
• Coordinates: 3937253..3937429 (-)
• Length: 58 a.a.
• NCBI ID: WP_181100122.1
• Uniprot ID: -
• Organism: Pseudomonas sp. MTM4
• Function: type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake

Genomic Context

Location: 3932253..3942429

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GYM54_RS18085 (GYM54_18080)	-	3932584..3932978 (-)	395	Protein_3589	nucleotidyltransferase domain-containing protein	-
GYM54_RS18090 (GYM54_18085)	-	3933150..3934187 (-)	1038	WP_181100112.1	acyltransferase	-
GYM54_RS18095 (GYM54_18090)	-	3934208..3935095 (-)	888	WP_181100114.1	ABC transporter ATP-binding protein	-
GYM54_RS18100 (GYM54_18095)	-	3935092..3935925 (-)	834	WP_181100116.1	hypothetical protein	-
GYM54_RS18105 (GYM54_18100)	-	3935922..3936722 (-)	801	WP_181100118.1	hypothetical protein	-
GYM54_RS18110 (GYM54_18105)	-	3936781..3937233 (-)	453	WP_181100120.1	hypothetical protein	-
GYM54_RS21890 (GYM54_18110)	pilA	3937253..3937429 (-)	177	WP_181100122.1	type IV pilin protein	Machinery gene
GYM54_RS18120 (GYM54_18115)	pilB	3937941..3939644 (+)	1704	WP_181100124.1	type IV-A pilus assembly ATPase PilB	Machinery gene
GYM54_RS18125 (GYM54_18120)	pilC	3939647..3940870 (+)	1224	WP_181100126.1	type II secretion system F family protein	Machinery gene
GYM54_RS18130 (GYM54_18125)	pilD	3940875..3941738 (+)	864	WP_181100129.1	A24 family peptidase	Machinery gene

Sequence

Protein

• Length: 58 a.a.
• Molecular weight: 6225.27 Da
• Isoelectric Point: 9.7375

>NTDB_id=421179 GYM54_RS21890 WP_181100122.1 3937253..3937429(-) (pilA) [Pseudomonas sp. MTM4]
MKKQKGFTLIELMIVVAIIGILAAVAIPQFQDYQAKGYDKSAQSDARNILTGGIANSN

Nucleotide

• Length: 177 bp

>NTDB_id=421179 GYM54_RS21890 WP_181100122.1 3937253..3937429(-) (pilA) [Pseudomonas sp. MTM4]
ATGAAGAAGCAAAAAGGCTTTACCCTGATTGAGCTGATGATCGTGGTCGCGATCATCGGAATCCTGGCTGCAGTCGCCAT
TCCGCAATTCCAGGATTACCAAGCCAAGGGCTACGACAAGTCGGCGCAATCCGACGCTCGTAATATCCTGACCGGCGGCA
TCGCCAACTCCAACTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (1-26)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Acinetobacter baumannii strain A118	67.308	89.655	0.603
pilA	Pseudomonas aeruginosa PAK	76.19	72.414	0.552
pilA	Ralstonia pseudosolanacearum GMI1000	60	86.207	0.517
pilA	Vibrio campbellii strain DS40M4	80.556	62.069	0.5
pilA	Acinetobacter nosocomialis M2	80.556	62.069	0.5
pilA	Vibrio parahaemolyticus RIMD 2210633	56	86.207	0.483
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	56	86.207	0.483
pilA2	Legionella pneumophila str. Paris	79.412	58.621	0.466
pilA2	Legionella pneumophila strain ERS1305867	79.412	58.621	0.466
pilA/pilA1	Eikenella corrodens VA1	77.143	60.345	0.466
pilA	Vibrio cholerae C6706	77.143	60.345	0.466
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	77.143	60.345	0.466
pilA	Vibrio cholerae strain A1552	77.143	60.345	0.466
pilE	Acinetobacter baumannii D1279779	56.522	79.31	0.448
comF	Acinetobacter baylyi ADP1	57.778	77.586	0.448
pilA/pilAI	Pseudomonas stutzeri DSM 10701	78.788	56.897	0.448
pilE	Neisseria gonorrhoeae MS11	78.788	56.897	0.448
pilE	Neisseria gonorrhoeae strain FA1090	78.788	56.897	0.448
comP	Acinetobacter baylyi ADP1	72.222	62.069	0.448
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	75.758	56.897	0.431
pilA/pilAII	Pseudomonas stutzeri DSM 10701	58.537	70.69	0.414
pilX	Neisseria meningitidis 8013	66.667	62.069	0.414
pilL	Neisseria gonorrhoeae MS11	66.667	62.069	0.414
pilA	Haemophilus influenzae Rd KW20	69.697	56.897	0.397
pilA	Haemophilus influenzae 86-028NP	69.697	56.897	0.397
pilA	Glaesserella parasuis strain SC1401	65.625	55.172	0.362