Detailed information NTG0398733

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: GII23_RS22155
• Genome accession: NZ_CP045858
• Coordinates: 1573830..1574015 (-)
• Length: 61 a.a.
• NCBI ID: WP_165562831.1
• Uniprot ID: -
• Organism: Stutzerimonas balearica strain EC28
• Function: type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1568830..1579015

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GII23_RS07250 (GII23_07230)	-	1569721..1570764 (-)	1044	WP_165562826.1	acyltransferase	-
GII23_RS07255 (GII23_07235)	-	1570788..1571672 (-)	885	WP_165562827.1	ABC transporter ATP-binding protein	-
GII23_RS07260 (GII23_07240)	-	1571669..1572502 (-)	834	WP_165562828.1	hypothetical protein	-
GII23_RS07265 (GII23_07245)	-	1572499..1573299 (-)	801	WP_165562829.1	ABC transporter permease	-
GII23_RS07270 (GII23_07250)	-	1573357..1573812 (-)	456	WP_165562830.1	hypothetical protein	-
GII23_RS22155 (GII23_07255)	pilA	1573830..1574015 (-)	186	WP_165562831.1	type IV pilin protein	Machinery gene
GII23_RS07280 (GII23_07260)	pilB	1574355..1576058 (+)	1704	WP_165562832.1	type IV-A pilus assembly ATPase PilB	Machinery gene
GII23_RS07285 (GII23_07265)	pilC	1576061..1577281 (+)	1221	WP_165562833.1	type II secretion system F family protein	Machinery gene
GII23_RS07290 (GII23_07270)	pilD	1577287..1578150 (+)	864	WP_165562834.1	A24 family peptidase	Machinery gene
GII23_RS07295 (GII23_07275)	coaE	1578282..1578890 (+)	609	WP_165562835.1	dephospho-CoA kinase	-

Sequence

Protein

• Length: 61 a.a.
• Molecular weight: 6567.71 Da
• Isoelectric Point: 10.1002

>NTDB_id=398733 GII23_RS22155 WP_165562831.1 1573830..1574015(-) (pilA) [Stutzerimonas balearica strain EC28]
MKSIKKQKGFTLIELMIVVAIIGILAAVAIPQFQDYQAKGYDKSAQSDARNILTGAIANSN

Nucleotide

• Length: 186 bp

>NTDB_id=398733 GII23_RS22155 WP_165562831.1 1573830..1574015(-) (pilA) [Stutzerimonas balearica strain EC28]
ATGAAGTCCATCAAGAAGCAAAAAGGTTTTACCCTGATCGAGCTGATGATCGTGGTCGCGATCATCGGCATCCTGGCCGC
AGTCGCCATTCCGCAGTTCCAGGATTACCAAGCCAAGGGCTATGACAAGTCGGCTCAGTCCGATGCGCGCAATATCTTGA
CCGGCGCAATCGCCAACTCTAACTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-29)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Acinetobacter baumannii strain A118	69.388	80.328	0.557
pilA	Ralstonia pseudosolanacearum GMI1000	55.932	96.721	0.541
pilA	Pseudomonas aeruginosa PAK	73.81	68.852	0.508
pilA	Vibrio campbellii strain DS40M4	80.556	59.016	0.475
pilA	Vibrio parahaemolyticus RIMD 2210633	55.769	85.246	0.475
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	56	81.967	0.459
pilA	Acinetobacter nosocomialis M2	84.848	54.098	0.459
pilA2	Legionella pneumophila strain ERS1305867	87.097	50.82	0.443
pilA2	Legionella pneumophila str. Paris	87.097	50.82	0.443
pilA/pilA1	Eikenella corrodens VA1	77.143	57.377	0.443
pilA	Vibrio cholerae C6706	77.143	57.377	0.443
pilA	Vibrio cholerae strain A1552	77.143	57.377	0.443
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	77.143	57.377	0.443
pilA/pilAII	Pseudomonas stutzeri DSM 10701	55.102	80.328	0.443
pilE	Acinetobacter baumannii D1279779	56.522	75.41	0.426
pilA/pilAI	Pseudomonas stutzeri DSM 10701	78.788	54.098	0.426
pilE	Neisseria gonorrhoeae MS11	78.788	54.098	0.426
pilE	Neisseria gonorrhoeae strain FA1090	78.788	54.098	0.426
comF	Acinetobacter baylyi ADP1	55.556	73.77	0.41
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	75.758	54.098	0.41
comP	Acinetobacter baylyi ADP1	69.444	59.016	0.41
pilL	Neisseria gonorrhoeae MS11	66.667	59.016	0.393
pilX	Neisseria meningitidis 8013	66.667	59.016	0.393
pilA	Haemophilus influenzae 86-028NP	69.697	54.098	0.377
pilA	Haemophilus influenzae Rd KW20	69.697	54.098	0.377
fimU	Acinetobacter baumannii D1279779	38.596	93.443	0.361