Detailed information NTG0557965

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: KCX70_RS23435
• Genome accession: NZ_CP073105
• Coordinates: 998259..998444 (-)
• Length: 61 a.a.
• NCBI ID: WP_156716308.1
• Uniprot ID: -
• Organism: Stutzerimonas stutzeri strain F2
• Function: type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake

Genomic Context

Location: 993259..1003444

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
KCX70_RS04765 (KCX70_04765)	-	995240..996127 (-)	888	WP_212619453.1	ABC transporter ATP-binding protein	-
KCX70_RS04770 (KCX70_04770)	-	996124..996957 (-)	834	WP_212619454.1	hypothetical protein	-
KCX70_RS04775 (KCX70_04775)	-	996954..997754 (-)	801	WP_212619455.1	hypothetical protein	-
KCX70_RS04780 (KCX70_04780)	-	997814..998239 (-)	426	WP_212619456.1	hypothetical protein	-
KCX70_RS23435 (KCX70_04785)	pilA	998259..998444 (-)	186	WP_156716308.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
KCX70_RS04790 (KCX70_04790)	pilB	998985..1000691 (+)	1707	WP_212619457.1	type IV-A pilus assembly ATPase PilB	Machinery gene
KCX70_RS04795 (KCX70_04795)	pilC	1000694..1001917 (+)	1224	WP_212619458.1	type II secretion system F family protein	Machinery gene
KCX70_RS04800 (KCX70_04800)	pilD	1001914..1002780 (+)	867	WP_102846952.1	A24 family peptidase	Machinery gene

Sequence

Protein

• Length: 61 a.a.
• Molecular weight: 6553.68 Da
• Isoelectric Point: 10.1002

>NTDB_id=557965 KCX70_RS23435 WP_156716308.1 998259..998444(-) (pilA) [Stutzerimonas stutzeri strain F2]
MKSIKKQKGFTLIELMIVVAIIGILAAVAIPQFQDYQAKGYDKSAQSDARNILTGGIANSN

Nucleotide

• Length: 186 bp

>NTDB_id=557965 KCX70_RS23435 WP_156716308.1 998259..998444(-) (pilA) [Stutzerimonas stutzeri strain F2]
ATGAAGTCCATCAAGAAGCAAAAAGGTTTCACCCTGATCGAGCTGATGATCGTAGTTGCGATCATTGGCATCTTGGCAGC
AGTAGCCATCCCGCAGTTTCAAGACTACCAAGCCAAGGGCTACGACAAGTCGGCTCAGTCTGATGCCCGCAACATCCTGA
CCGGCGGCATCGCCAACTCCAACTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-29)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Acinetobacter baumannii strain A118	69.388	80.328	0.557
pilA	Ralstonia pseudosolanacearum GMI1000	55.932	96.721	0.541
pilA	Pseudomonas aeruginosa PAK	73.81	68.852	0.508
pilA	Vibrio campbellii strain DS40M4	80.556	59.016	0.475
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	56	81.967	0.459
pilA	Vibrio parahaemolyticus RIMD 2210633	56	81.967	0.459
pilA	Acinetobacter nosocomialis M2	84.848	54.098	0.459
pilA2	Legionella pneumophila strain ERS1305867	87.097	50.82	0.443
pilA2	Legionella pneumophila str. Paris	87.097	50.82	0.443
pilA	Vibrio cholerae C6706	77.143	57.377	0.443
pilA	Vibrio cholerae strain A1552	77.143	57.377	0.443
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	77.143	57.377	0.443
pilA/pilA1	Eikenella corrodens VA1	77.143	57.377	0.443
pilA/pilAII	Pseudomonas stutzeri DSM 10701	55.102	80.328	0.443
pilE	Acinetobacter baumannii D1279779	56.522	75.41	0.426
pilA/pilAI	Pseudomonas stutzeri DSM 10701	78.788	54.098	0.426
pilE	Neisseria gonorrhoeae strain FA1090	78.788	54.098	0.426
pilE	Neisseria gonorrhoeae MS11	78.788	54.098	0.426
comF	Acinetobacter baylyi ADP1	55.556	73.77	0.41
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	75.758	54.098	0.41
comP	Acinetobacter baylyi ADP1	69.444	59.016	0.41
pilX	Neisseria meningitidis 8013	66.667	59.016	0.393
pilL	Neisseria gonorrhoeae MS11	66.667	59.016	0.393
pilA	Haemophilus influenzae 86-028NP	69.697	54.098	0.377
pilA	Haemophilus influenzae Rd KW20	69.697	54.098	0.377