Detailed information NTG0540344

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: JWV26_RS24530
• Genome accession: NZ_CP070505
• Coordinates: 3236962..3237141 (+)
• Length: 59 a.a.
• NCBI ID: WP_206417198.1
• Uniprot ID: -
• Organism: Ectopseudomonas toyotomiensis strain SM2
• Function: type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake

Genomic Context

Location: 3231962..3242141

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
JWV26_RS14810 (JWV26_14810)	pilD	3232189..3233055 (-)	867	WP_206417194.1	prepilin peptidase	Machinery gene
JWV26_RS14815 (JWV26_14815)	pilC	3233059..3234279 (-)	1221	WP_206417195.1	type II secretion system F family protein	Machinery gene
JWV26_RS14820 (JWV26_14820)	pilB	3234283..3235983 (-)	1701	WP_206417196.1	type IV-A pilus assembly ATPase PilB	Machinery gene
JWV26_RS24525 (JWV26_14825)	-	3236212..3236397 (+)	186	WP_003242736.1	type IV pilin protein	-
JWV26_RS14830 (JWV26_14830)	-	3236409..3236864 (+)	456	WP_206417197.1	hypothetical protein	-
JWV26_RS24530 (JWV26_14835)	pilA	3236962..3237141 (+)	180	WP_206417198.1	type IV pilin protein	Machinery gene
JWV26_RS14840 (JWV26_14840)	-	3237376..3238017 (+)	642	WP_241201220.1	hypothetical protein	-
JWV26_RS14845 (JWV26_14845)	-	3237987..3238859 (+)	873	WP_241201221.1	hypothetical protein	-
JWV26_RS14850 (JWV26_14850)	-	3238856..3239767 (+)	912	WP_206417199.1	ABC transporter ATP-binding protein	-
JWV26_RS14855 (JWV26_14855)	nadC	3239881..3240729 (-)	849	WP_206417200.1	carboxylating nicotinate-nucleotide diphosphorylase	-

Sequence

Protein

• Length: 59 a.a.
• Molecular weight: 6465.60 Da
• Isoelectric Point: 10.4690

>NTDB_id=540344 JWV26_RS24530 WP_206417198.1 3236962..3237141(+) (pilA) [Ectopseudomonas toyotomiensis strain SM2]
MRSKNSGFTLIELMIVVAIIGILAAIAIPQFNEYRAKANDANAQADVKNSLWIMASSRK

Nucleotide

• Length: 180 bp

>NTDB_id=540344 JWV26_RS24530 WP_206417198.1 3236962..3237141(+) (pilA) [Ectopseudomonas toyotomiensis strain SM2]
ATGCGTTCTAAAAATTCCGGCTTCACATTGATCGAATTGATGATCGTGGTCGCCATTATCGGCATTCTTGCCGCCATCGC
CATTCCTCAGTTCAATGAGTATCGCGCCAAGGCGAACGACGCCAATGCCCAAGCCGACGTCAAGAACTCTTTGTGGATCA
TGGCTTCCTCGCGGAAGTGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-28)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA2	Legionella pneumophila strain ERS1305867	64.583	81.356	0.525
pilA2	Legionella pneumophila str. Paris	64.583	81.356	0.525
pilA	Pseudomonas aeruginosa PAK	73.171	69.492	0.508
pilA	Ralstonia pseudosolanacearum GMI1000	50.847	100	0.508
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	50	98.305	0.492
pilA/pilAI	Pseudomonas stutzeri DSM 10701	65.854	69.492	0.458
comF	Acinetobacter baylyi ADP1	57.447	79.661	0.458
pilA	Acinetobacter nosocomialis M2	72.973	62.712	0.458
pilA	Acinetobacter baumannii strain A118	84.375	54.237	0.458
comE	Acinetobacter baylyi ADP1	54.167	81.356	0.441
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	60.465	72.881	0.441
pilA/pilAII	Pseudomonas stutzeri DSM 10701	55.319	79.661	0.441
pilA	Vibrio parahaemolyticus RIMD 2210633	55.319	79.661	0.441
pilA	Vibrio campbellii strain DS40M4	70.27	62.712	0.441
pilA/pilA1	Eikenella corrodens VA1	63.158	64.407	0.407
pilE	Acinetobacter baumannii D1279779	55.814	72.881	0.407
comP	Acinetobacter baylyi ADP1	75	54.237	0.407
pilA	Vibrio cholerae C6706	68.571	59.322	0.407
pilA	Vibrio cholerae strain A1552	68.571	59.322	0.407
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	68.571	59.322	0.407
pilA	Haemophilus influenzae 86-028NP	71.875	54.237	0.39
pilA	Haemophilus influenzae Rd KW20	60.526	64.407	0.39
pilE	Neisseria gonorrhoeae MS11	60.526	64.407	0.39
pilE	Neisseria gonorrhoeae strain FA1090	58.974	66.102	0.39
pilA	Glaesserella parasuis strain SC1401	70.968	52.542	0.373