Detailed information NTG0051783

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: A458_RS45270
• Genome accession: NC_018028
• Coordinates: 3556402..3556587 (+)
• Length: 61 a.a.
• NCBI ID: WP_014821363.1
• Uniprot ID: I4CWR3
• Organism: Stutzerimonas stutzeri CCUG 29243
• Function: type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake

Genomic Context

Location: 3551402..3561587

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
A458_RS38240 (A458_16455)	coaE	3551526..3552134 (-)	609	WP_014821359.1	dephospho-CoA kinase	-
A458_RS38245 (A458_16460)	pilD	3552266..3553129 (-)	864	WP_014821360.1	prepilin peptidase	Machinery gene
A458_RS38250 (A458_16465)	pilC	3553135..3554355 (-)	1221	WP_014821361.1	type II secretion system F family protein	Machinery gene
A458_RS38255 (A458_16470)	pilB	3554358..3556061 (-)	1704	WP_014821362.1	type IV-A pilus assembly ATPase PilB	Machinery gene
A458_RS45270 (A458_16475)	pilA	3556402..3556587 (+)	186	WP_014821363.1	type IV pilin protein	Machinery gene
A458_RS38265 (A458_16480)	-	3556608..3557042 (+)	435	WP_014821364.1	hypothetical protein	-
A458_RS38270 (A458_16485)	-	3557108..3557908 (+)	801	WP_014821365.1	ABC transporter permease subunit	-
A458_RS38275 (A458_16490)	-	3557905..3558738 (+)	834	WP_148273160.1	hypothetical protein	-
A458_RS38280 (A458_16495)	-	3558735..3559619 (+)	885	WP_014821367.1	ABC transporter ATP-binding protein	-
A458_RS38285 (A458_16500)	-	3559635..3560678 (+)	1044	WP_014821368.1	acyltransferase family protein	-

Sequence

Protein

• Length: 61 a.a.
• Molecular weight: 6585.70 Da
• Isoelectric Point: 9.7375

>NTDB_id=51783 A458_RS45270 WP_014821363.1 3556402..3556587(+) (pilA) [Stutzerimonas stutzeri CCUG 29243]
MKSIKQQKGFTLIELMIVVAIIGILAAVAIPQFQDYQAKGYDKSAQSDARNIMTGAIANSN

Nucleotide

• Length: 186 bp

>NTDB_id=51783 A458_RS45270 WP_014821363.1 3556402..3556587(+) (pilA) [Stutzerimonas stutzeri CCUG 29243]
ATGAAGTCCATCAAGCAGCAAAAGGGTTTCACGCTGATCGAACTGATGATCGTGGTCGCGATCATCGGCATCCTGGCCGC
AGTCGCCATTCCACAGTTCCAGGATTACCAGGCTAAGGGCTATGACAAGTCGGCTCAGTCCGATGCGCGCAATATCATGA
CCGGCGCCATCGCCAACTCCAACTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-29)

3D structure

• AlphaFold DB: I4CWR3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Acinetobacter baumannii strain A118	69.388	80.328	0.557
pilA	Ralstonia pseudosolanacearum GMI1000	55.932	96.721	0.541
pilA	Pseudomonas aeruginosa PAK	73.81	68.852	0.508
pilA	Vibrio campbellii strain DS40M4	73.81	68.852	0.508
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	57.407	88.525	0.508
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	80	57.377	0.459
pilA	Vibrio cholerae strain A1552	80	57.377	0.459
pilA	Vibrio cholerae C6706	80	57.377	0.459
pilA	Vibrio parahaemolyticus RIMD 2210633	53.846	85.246	0.459
pilA	Acinetobacter nosocomialis M2	84.848	54.098	0.459
pilA	Haemophilus influenzae 86-028NP	64.286	68.852	0.443
pilA2	Legionella pneumophila strain ERS1305867	87.097	50.82	0.443
pilA2	Legionella pneumophila str. Paris	87.097	50.82	0.443
pilA/pilA1	Eikenella corrodens VA1	77.143	57.377	0.443
pilA/pilAII	Pseudomonas stutzeri DSM 10701	55.102	80.328	0.443
pilE	Acinetobacter baumannii D1279779	56.522	75.41	0.426
pilA/pilAI	Pseudomonas stutzeri DSM 10701	78.788	54.098	0.426
pilE	Neisseria gonorrhoeae strain FA1090	78.788	54.098	0.426
pilE	Neisseria gonorrhoeae MS11	78.788	54.098	0.426
comF	Acinetobacter baylyi ADP1	55.556	73.77	0.41
comP	Acinetobacter baylyi ADP1	75.758	54.098	0.41
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	75.758	54.098	0.41
pilL	Neisseria gonorrhoeae MS11	66.667	59.016	0.393
pilX	Neisseria meningitidis 8013	66.667	59.016	0.393
pilA	Haemophilus influenzae Rd KW20	69.697	54.098	0.377