NTDB

Overview

Name	pilA	Type	Machinery gene
Locus tag	HIR79_RS18645	Genome accession	NZ_CP053032
Coordinates	1842053..1842208 (+)	Length	51 a.a.
NCBI ID	WP_283241860.1	Uniprot ID	-
Organism	Halomonas sp. PGE1
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1837053..1847208

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HIR79_RS08695 (HIR79_08695)	-	1838250..1838891 (-)	642	WP_169958028.1	type I-E CRISPR-associated protein Cas6/Cse3/CasE	-
HIR79_RS08700 (HIR79_08700)	-	1838888..1839910 (-)	1023	WP_169958029.1	hypothetical protein	-
HIR79_RS08705 (HIR79_08705)	-	1839903..1840568 (-)	666	WP_169958030.1	hypothetical protein	-
HIR79_RS08710 (HIR79_08710)	-	1840571..1841626 (-)	1056	WP_169958031.1	hypothetical protein	-
HIR79_RS18645	pilA	1842053..1842208 (+)	156	WP_283241860.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
HIR79_RS08720 (HIR79_08720)	lepA	1842968..1844785 (+)	1818	WP_169958032.1	translation elongation factor 4	-
HIR79_RS08725 (HIR79_08725)	lepB	1844813..1845616 (+)	804	WP_169958033.1	signal peptidase I	-
HIR79_RS08730 (HIR79_08730)	rnc	1845696..1846400 (+)	705	WP_169958034.1	ribonuclease III	-

Sequence

Protein

Download Length: 51 a.a. Molecular weight: 5566.58 Da Isoelectric Point: 8.6181

                                >NTDB_id=442331 HIR79_RS18645 WP_283241860.1 1842053..1842208(+) (pilA) [Halomonas sp. PGE1]

MSTVTEMNELSGKARRNRAQGGFTLIELMIVVAIIGILAAIAIPRYQDYVA

Nucleotide

Download Length: 156 bp

                                >NTDB_id=442331 HIR79_RS18645 WP_283241860.1 1842053..1842208(+) (pilA) [Halomonas sp. PGE1]

ATGAGCACGGTAACAGAGATGAACGAGTTGAGCGGAAAGGCGCGGCGCAACAGGGCGCAGGGCGGTTTTACCCTGATCGA

GCTGATGATCGTGGTAGCGATCATCGGTATTCTGGCGGCAATTGCGATTCCTAGATATCAAGACTATGTAGCATGA

Domains

Predicted by InterProScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(18-43)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA	Pseudomonas aeruginosa PAK	88.235	66.667	0.588
pilA	Vibrio cholerae strain A1552	76.316	74.51	0.569
pilA	Vibrio cholerae C6706	76.316	74.51	0.569
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	76.316	74.51	0.569
pilA	Acinetobacter nosocomialis M2	85.294	66.667	0.569
pilA	Acinetobacter baumannii strain A118	85.294	66.667	0.569
pilA2	Legionella pneumophila strain ERS1305867	90.323	60.784	0.549
pilA2	Legionella pneumophila str. Paris	90.323	60.784	0.549
pilA	Vibrio campbellii strain DS40M4	75.676	72.549	0.549
pilA	Ralstonia pseudosolanacearum GMI1000	82.353	66.667	0.549
pilA	Vibrio parahaemolyticus RIMD 2210633	71.053	74.51	0.529
pilA/pilA1	Eikenella corrodens VA1	79.412	66.667	0.529
pilA/pilAI	Pseudomonas stutzeri DSM 10701	87.097	60.784	0.529
comP	Acinetobacter baylyi ADP1	81.818	64.706	0.529
pilE	Neisseria gonorrhoeae strain FA1090	74.286	68.627	0.51
pilE	Neisseria gonorrhoeae MS11	74.286	68.627	0.51
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	86.667	58.824	0.51
comF	Acinetobacter baylyi ADP1	81.25	62.745	0.51
pilA/pilAII	Pseudomonas stutzeri DSM 10701	82.759	56.863	0.471
pilA	Haemophilus influenzae 86-028NP	79.31	56.863	0.451
pilA	Haemophilus influenzae Rd KW20	79.31	56.863	0.451
pilL	Neisseria gonorrhoeae MS11	70.968	60.784	0.431
pilX	Neisseria meningitidis 8013	70.968	60.784	0.431
comE	Acinetobacter baylyi ADP1	75.862	56.863	0.431
pilA/pilA1	Synechocystis sp. PCC 6803	70	58.824	0.412
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	70	58.824	0.412
pilY2	Acinetobacter baumannii D1279779	62.5	62.745	0.392

Detailed information NTG0442331