Detailed information NTG0296003

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: DM292_RS21835
• Genome accession: NZ_CP029772
• Coordinates: 3002997..3003182 (+)
• Length: 61 a.a.
• NCBI ID: WP_110777984.1
• Uniprot ID: -
• Organism: Stutzerimonas frequens strain R2A2
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	2998094..3006558	3002997..3003182	within	0

Gene organization within MGE regions

Location: 2998094..3006558

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
DM292_RS13985 (DM292_13985)	coaE	2998094..2998702 (-)	609	WP_110777979.1	dephospho-CoA kinase	-
DM292_RS13990 (DM292_13990)	pilD	2998835..2999701 (-)	867	WP_110777981.1	A24 family peptidase	Machinery gene
DM292_RS13995 (DM292_13995)	pilC	2999705..3000925 (-)	1221	WP_063544459.1	type II secretion system F family protein	Machinery gene
DM292_RS14000 (DM292_14000)	pilB	3000928..3002631 (-)	1704	WP_110777982.1	type IV-A pilus assembly ATPase PilB	Machinery gene
DM292_RS21835 (DM292_14005)	pilA	3002997..3003182 (+)	186	WP_110777984.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
DM292_RS21470	-	3003197..3003643 (+)	447	WP_162621589.1	hypothetical protein	-
DM292_RS14010 (DM292_14010)	-	3003715..3003894 (+)	180	WP_110777985.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
DM292_RS14015 (DM292_14015)	-	3004015..3004824 (+)	810	WP_110777986.1	ABC transporter permease	-
DM292_RS14020 (DM292_14020)	-	3004826..3005665 (+)	840	WP_230725236.1	hypothetical protein	-
DM292_RS14025 (DM292_14025)	-	3005662..3006558 (+)	897	WP_110777987.1	ABC transporter ATP-binding protein	-

Sequence

Protein

• Length: 61 a.a.
• Molecular weight: 6564.77 Da
• Isoelectric Point: 9.9318

>NTDB_id=296003 DM292_RS21835 WP_110777984.1 3002997..3003182(+) (pilA) [Stutzerimonas frequens strain R2A2]
MKSIKKQNGFTLIELMIVVAIIGILAAIAIPQFNEYRAKSNDTVANADAKNTLTVMSAAQL

Nucleotide

• Length: 186 bp

>NTDB_id=296003 DM292_RS21835 WP_110777984.1 3002997..3003182(+) (pilA) [Stutzerimonas frequens strain R2A2]
ATGAAGTCCATCAAGAAGCAAAACGGTTTTACCCTGATTGAACTTATGATCGTAGTAGCGATCATCGGCATTCTGGCGGC
AATCGCTATTCCGCAGTTCAACGAATATCGTGCTAAATCCAACGATACCGTCGCAAACGCGGATGCAAAAAACACCCTGA
CCGTCATGTCTGCCGCCCAACTTTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Vibrio parahaemolyticus RIMD 2210633	60	81.967	0.492
pilA	Pseudomonas aeruginosa PAK	76.316	62.295	0.475
pilA	Acinetobacter baumannii strain A118	85.294	55.738	0.475
pilA2	Legionella pneumophila strain ERS1305867	63.043	75.41	0.475
pilA2	Legionella pneumophila str. Paris	63.043	75.41	0.475
pilA	Acinetobacter nosocomialis M2	82.353	55.738	0.459
pilA	Ralstonia pseudosolanacearum GMI1000	58.333	78.689	0.459
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	75	59.016	0.443
pilA	Vibrio cholerae strain A1552	75	59.016	0.443
pilA	Vibrio cholerae C6706	75	59.016	0.443
pilA	Vibrio campbellii strain DS40M4	75	59.016	0.443
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	51.923	85.246	0.443
pilA/pilA1	Eikenella corrodens VA1	66.667	63.934	0.426
pilA/pilAI	Pseudomonas stutzeri DSM 10701	74.286	57.377	0.426
pilA/pilAII	Pseudomonas stutzeri DSM 10701	61.905	68.852	0.426
pilE	Acinetobacter baumannii D1279779	55.556	73.77	0.41
comF	Acinetobacter baylyi ADP1	63.158	62.295	0.393
pilA	Haemophilus influenzae Rd KW20	60	65.574	0.393
pilA/pilA1	Synechocystis sp. PCC 6803	42.857	91.803	0.393
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	70.588	55.738	0.393
pilA	Haemophilus influenzae 86-028NP	61.538	63.934	0.393
pilA/pilA4	Thermus thermophilus HB27	54.545	72.131	0.393
pilE	Legionella pneumophila str. Paris	46.939	80.328	0.377
pilE	Legionella pneumophila strain ERS1305867	46.939	80.328	0.377
comE	Acinetobacter baylyi ADP1	62.162	60.656	0.377
pilE	Neisseria gonorrhoeae strain FA1090	64.706	55.738	0.361
pilE	Neisseria gonorrhoeae MS11	64.706	55.738	0.361