Detailed information NTG0247176

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: CCZ27_RS24605
• Genome accession: NZ_CP023439
• Coordinates: 384981..385163 (+)
• Length: 60 a.a.
• NCBI ID: WP_332460891.1
• Uniprot ID: -
• Organism: Thauera sp. K11
• Function: type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake

Genomic Context

Location: 379981..390163

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CCZ27_RS01770 (CCZ27_01770)	waaA	380102..381367 (-)	1266	WP_096445090.1	lipid IV(A) 3-deoxy-D-manno-octulosonic acid transferase	-
CCZ27_RS01775 (CCZ27_01775)	-	381511..382518 (+)	1008	WP_096445091.1	NAD-dependent epimerase	-
CCZ27_RS01780 (CCZ27_01780)	-	382627..383898 (-)	1272	WP_232516530.1	MFS transporter	-
CCZ27_RS01785 (CCZ27_01785)	-	384087..384317 (+)	231	WP_096445093.1	type II toxin-antitoxin system prevent-host-death family antitoxin	-
CCZ27_RS01790 (CCZ27_01790)	-	384317..384703 (+)	387	WP_096445094.1	type II toxin-antitoxin system VapC family toxin	-
CCZ27_RS24605 (CCZ27_01795)	pilA	384981..385163 (+)	183	WP_332460891.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
CCZ27_RS23225	-	385175..385612 (+)	438	WP_157748412.1	hypothetical protein	-
CCZ27_RS01800 (CCZ27_01800)	-	385817..386695 (+)	879	WP_232516531.1	hypothetical protein	-
CCZ27_RS01805 (CCZ27_01805)	-	386692..387546 (+)	855	WP_198363239.1	hypothetical protein	-
CCZ27_RS01810 (CCZ27_01810)	-	387543..388496 (+)	954	WP_096445095.1	ABC transporter ATP-binding protein	-
CCZ27_RS23895	-	388911..389174 (+)	264	WP_232516532.1	nucleotidyltransferase substrate binding protein	-
CCZ27_RS01820 (CCZ27_01820)	-	389171..389497 (+)	327	WP_096445096.1	nucleotidyltransferase domain-containing protein	-
CCZ27_RS01825 (CCZ27_01825)	-	389636..390055 (-)	420	WP_096445097.1	CBS domain-containing protein	-

Sequence

Protein

• Length: 60 a.a.
• Molecular weight: 6479.76 Da
• Isoelectric Point: 10.2806

>NTDB_id=247176 CCZ27_RS24605 WP_332460891.1 384981..385163(+) (pilA) [Thauera sp. K11]
MMKKMQKGFTLIELMIVVAIIGILAAIAIPQFNEYRAKANDSSAQADVKNGLTVLTAAQK

Nucleotide

• Length: 183 bp

>NTDB_id=247176 CCZ27_RS24605 WP_332460891.1 384981..385163(+) (pilA) [Thauera sp. K11]
ATGATGAAGAAAATGCAGAAAGGCTTCACCCTGATCGAGCTGATGATCGTCGTGGCGATCATCGGCATCCTGGCGGCGAT
CGCGATCCCGCAATTCAACGAGTATCGTGCCAAGGCAAACGATTCGTCGGCCCAGGCAGATGTCAAGAATGGCCTTACCG
TGCTCACCGCTGCGCAGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (3-29)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	50.704	100	0.6
pilA	Ralstonia pseudosolanacearum GMI1000	47.222	100	0.567
pilA	Pseudomonas aeruginosa PAK	73.333	75	0.55
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	55.172	96.667	0.533
pilA/pilAI	Pseudomonas stutzeri DSM 10701	60.784	85	0.517
pilA	Acinetobacter baumannii strain A118	66.667	75	0.5
pilA2	Legionella pneumophila str. Paris	68.182	73.333	0.5
pilA2	Legionella pneumophila strain ERS1305867	68.182	73.333	0.5
pilA	Acinetobacter nosocomialis M2	76.923	65	0.5
pilA/pilA1	Eikenella corrodens VA1	74.359	65	0.483
pilA	Vibrio parahaemolyticus RIMD 2210633	59.574	78.333	0.467
pilE	Neisseria gonorrhoeae strain FA1090	62.791	71.667	0.45
pilE	Neisseria gonorrhoeae MS11	62.791	71.667	0.45
pilA	Vibrio campbellii strain DS40M4	72.973	61.667	0.45
pilA	Vibrio cholerae C6706	75	60	0.45
pilA	Vibrio cholerae strain A1552	75	60	0.45
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	75	60	0.45
comP	Acinetobacter baylyi ADP1	76.471	56.667	0.433
comF	Acinetobacter baylyi ADP1	57.778	75	0.433
pilA/pilAII	Pseudomonas stutzeri DSM 10701	55.319	78.333	0.433
pilE	Acinetobacter baumannii D1279779	54.348	76.667	0.417
comE	Acinetobacter baylyi ADP1	52.083	80	0.417
pilA	Haemophilus influenzae 86-028NP	64.865	61.667	0.4
pilA	Haemophilus influenzae Rd KW20	63.158	63.333	0.4
pilA/pilA4	Thermus thermophilus HB27	63.889	60	0.383
pilA/pilA1	Synechocystis sp. PCC 6803	50	76.667	0.383
pilX	Neisseria meningitidis 8013	62.162	61.667	0.383
pilL	Neisseria gonorrhoeae MS11	62.162	61.667	0.383
pilA	Glaesserella parasuis strain SC1401	58.974	65	0.383
pilH	Neisseria gonorrhoeae MS11	42.308	86.667	0.367