Detailed information NTG0142572

Bioinformatically predicted

Overview

• Name: pilB/pilB1
• Type: Machinery gene
• Locus tag: CleRt_RS08685
• Genome accession: NZ_CP011126
• Coordinates: 167779..167952 (+)
• Length: 57 a.a.
• NCBI ID: WP_082160388.1
• Uniprot ID: -
• Organism: Candidatus Coxiella mudrowiae strain CRt
• Function: type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake

Genomic Context

Location: 162779..172952

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CleRt_RS00750 (CleRT_01510)	pyk	163175..164638 (+)	1464	WP_082160385.1	pyruvate kinase	-
CleRt_RS00755 (CleRT_01520)	fba	164656..165738 (+)	1083	WP_048874823.1	class II fructose-bisphosphate aldolase	-
CleRt_RS00760	-	165954..166154 (+)	201	WP_048874824.1	secretin N-terminal domain-containing protein	-
CleRt_RS11130	-	166323..166783 (+)	461	Protein_192	type II secretion system protein GspD	-
CleRt_RS00770	-	166817..167023 (+)	207	WP_048874826.1	hypothetical protein	-
CleRt_RS09660	-	167290..167430 (+)	141	WP_157870759.1	hypothetical protein	-
CleRt_RS13815	pilB	167601..167750 (+)	150	WP_157870760.1	ATPase, T2SS/T4P/T4SS family	Machinery gene
CleRt_RS08685	pilB/pilB1	167779..167952 (+)	174	WP_082160388.1	ATPase, T2SS/T4P/T4SS family	Machinery gene
CleRt_RS13820	-	167967..168044 (+)	78	WP_157870941.1	hypothetical protein	-
CleRt_RS13825	-	168052..168255 (+)	204	Protein_198	ATPase, T2SS/T4P/T4SS family	-
CleRt_RS08160	-	168225..168548 (+)	324	WP_053097813.1	hypothetical protein	-
CleRt_RS08690	-	169372..169773 (+)	402	WP_306686886.1	type II secretion system F family protein	-
CleRt_RS13830	pilA/pilA1	169821..169922 (+)	102	WP_371440240.1	type IV pilin protein	Machinery gene
CleRt_RS13835	-	169966..170145 (+)	180	WP_371440241.1	type II secretion system protein GspG	-
CleRt_RS09680	-	170284..170427 (+)	144	WP_157870764.1	hypothetical protein	-
CleRt_RS08695	-	170740..170880 (+)	141	Protein_204	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
CleRt_RS00795	-	171089..171412 (+)	324	WP_048874828.1	type II secretion system protein J	-
CleRt_RS00800	-	171477..171752 (+)	276	WP_048874829.1	type II secretion system protein GspJ	-
CleRt_RS12865	-	171862..171993 (+)	132	WP_306686721.1	hypothetical protein	-
CleRt_RS00805	-	172140..172343 (+)	204	WP_162198803.1	type II secretion system protein GspK	-
CleRt_RS09685	-	172416..172556 (+)	141	WP_157870765.1	hypothetical protein	-

Sequence

Protein

• Length: 57 a.a.
• Molecular weight: 6215.17 Da
• Isoelectric Point: 8.4739

>NTDB_id=142572 CleRt_RS08685 WP_082160388.1 167779..167952(+) (pilB/pilB1) [Candidatus Coxiella mudrowiae strain CRt]
MNFKTHGIILVTSPYTGSGKTTTLYAALTALNSVVRNILTVEDPIEYYLPQAGQTLK

Nucleotide

• Length: 174 bp

>NTDB_id=142572 CleRt_RS08685 WP_082160388.1 167779..167952(+) (pilB/pilB1) [Candidatus Coxiella mudrowiae strain CRt]
ATTAATTTTAAAACCCACGGTATTATTTTAGTGACCAGCCCCTACACGGGTTCGGGAAAAACAACCACTTTATATGCAGC
ATTAACAGCATTGAACAGCGTAGTGCGAAATATTTTAACGGTTGAAGATCCCATTGAATACTATTTACCTCAAGCAGGAC
AGACTCTCAAGTAA

Domains

Predicted by InterproScan.

• Type II/IV secretion system protein (T2SSE) (5-55)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilB/pilB1	Synechocystis sp. PCC 6803	56.863	89.474	0.509
pilB	Legionella pneumophila strain ERS1305867	54.902	89.474	0.491
ctsE	Campylobacter jejuni subsp. jejuni 81-176	52.83	92.982	0.491
pilB	Vibrio campbellii strain DS40M4	52.941	89.474	0.474
pilT	Acinetobacter baumannii D1279779	61.905	73.684	0.456
pilT	Acinetobacter baumannii strain A118	61.905	73.684	0.456
pilT	Acinetobacter nosocomialis M2	61.905	73.684	0.456
pilF	Neisseria gonorrhoeae MS11	50.98	89.474	0.456
pilB	Acinetobacter baumannii D1279779	49.02	89.474	0.439
pilB	Glaesserella parasuis strain SC1401	58.14	75.439	0.439
pilB	Vibrio parahaemolyticus RIMD 2210633	49.02	89.474	0.439
pilB	Acinetobacter baylyi ADP1	49.02	89.474	0.439
pilB	Vibrio cholerae strain A1552	49.02	89.474	0.439
pilT	Pseudomonas aeruginosa PAK	59.524	73.684	0.439
pilT	Acinetobacter baylyi ADP1	59.524	73.684	0.439
pilT	Pseudomonas stutzeri DSM 10701	59.524	73.684	0.439
pilB	Haemophilus influenzae Rd KW20	54.348	80.702	0.439
pilB	Haemophilus influenzae 86-028NP	54.348	80.702	0.439
pilT	Legionella pneumophila strain ERS1305867	56.818	77.193	0.439
pilT	Legionella pneumophila strain Lp02	56.818	77.193	0.439
pilB	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	44.231	91.228	0.404
pilF	Thermus thermophilus HB27	44.231	91.228	0.404
pilT	Neisseria gonorrhoeae MS11	54.762	73.684	0.404
pilT	Neisseria meningitidis 8013	54.762	73.684	0.404
pilT	Vibrio cholerae O1 biovar El Tor strain E7946	54.762	73.684	0.404
pilT	Vibrio cholerae strain A1552	54.762	73.684	0.404
pilT	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	50	80.702	0.404
comGA	Bacillus subtilis subsp. subtilis str. 168	53.488	75.439	0.404
pilU	Vibrio cholerae strain A1552	53.488	75.439	0.404