Detailed information NTG0142576

Bioinformatically predicted

Overview

• Name: pilB
• Type: Machinery gene
• Locus tag: CleRt_RS13815
• Genome accession: NZ_CP011126
• Coordinates: 167601..167750 (+)
• Length: 49 a.a.
• NCBI ID: WP_157870760.1
• Uniprot ID: -
• Organism: Candidatus Coxiella mudrowiae strain CRt
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 162601..172750

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CleRt_RS00750 (CleRT_01510)	pyk	163175..164638 (+)	1464	WP_082160385.1	pyruvate kinase	-
CleRt_RS00755 (CleRT_01520)	fba	164656..165738 (+)	1083	WP_048874823.1	class II fructose-bisphosphate aldolase	-
CleRt_RS00760	-	165954..166154 (+)	201	WP_048874824.1	secretin N-terminal domain-containing protein	-
CleRt_RS11130	-	166323..166783 (+)	461	Protein_192	type II secretion system protein GspD	-
CleRt_RS00770	-	166817..167023 (+)	207	WP_048874826.1	hypothetical protein	-
CleRt_RS09660	-	167290..167430 (+)	141	WP_157870759.1	hypothetical protein	-
CleRt_RS13815	pilB	167601..167750 (+)	150	WP_157870760.1	ATPase, T2SS/T4P/T4SS family	Machinery gene
CleRt_RS08685	pilB/pilB1	167779..167952 (+)	174	WP_082160388.1	ATPase, T2SS/T4P/T4SS family	Machinery gene
CleRt_RS13820	-	167967..168044 (+)	78	WP_157870941.1	hypothetical protein	-
CleRt_RS13825	-	168052..168255 (+)	204	Protein_198	ATPase, T2SS/T4P/T4SS family	-
CleRt_RS08160	-	168225..168548 (+)	324	WP_053097813.1	hypothetical protein	-
CleRt_RS08690	-	169372..169773 (+)	402	WP_306686886.1	type II secretion system F family protein	-
CleRt_RS13830	pilA/pilA1	169821..169922 (+)	102	WP_371440240.1	type IV pilin protein	Machinery gene
CleRt_RS13835	-	169966..170145 (+)	180	WP_371440241.1	type II secretion system protein GspG	-
CleRt_RS09680	-	170284..170427 (+)	144	WP_157870764.1	hypothetical protein	-
CleRt_RS08695	-	170740..170880 (+)	141	Protein_204	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
CleRt_RS00795	-	171089..171412 (+)	324	WP_048874828.1	type II secretion system protein J	-
CleRt_RS00800	-	171477..171752 (+)	276	WP_048874829.1	type II secretion system protein GspJ	-
CleRt_RS12865	-	171862..171993 (+)	132	WP_306686721.1	hypothetical protein	-
CleRt_RS00805	-	172140..172343 (+)	204	WP_162198803.1	type II secretion system protein GspK	-
CleRt_RS09685	-	172416..172556 (+)	141	WP_157870765.1	hypothetical protein	-

Sequence

Protein

• Length: 49 a.a.
• Molecular weight: 5601.58 Da
• Isoelectric Point: 10.2267

>NTDB_id=142576 CleRt_RS13815 WP_157870760.1 167601..167750(+) (pilB) [Candidatus Coxiella mudrowiae strain CRt]
MPQDGRIYLRIAGQAVDVRVSTIPTHFGERVVLRLLDKQSAHLICKNWV

Nucleotide

• Length: 150 bp

>NTDB_id=142576 CleRt_RS13815 WP_157870760.1 167601..167750(+) (pilB) [Candidatus Coxiella mudrowiae strain CRt]
TTGCCTCAGGATGGCCGTATTTATCTGCGAATTGCTGGTCAGGCCGTTGATGTTCGAGTATCTACAATTCCTACACACTT
CGGTGAGCGTGTCGTTTTGCGTTTGTTGGATAAACAGAGCGCCCATTTGATTTGCAAAAACTGGGTATGA

Domains

Predicted by InterproScan.

• Type II/IV secretion system protein (T2SSE) (2-44)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilB	Vibrio parahaemolyticus RIMD 2210633	61.364	89.796	0.551
pilB	Vibrio campbellii strain DS40M4	61.364	89.796	0.551
pilB	Vibrio cholerae strain A1552	59.091	89.796	0.531
pilF	Neisseria gonorrhoeae MS11	53.333	91.837	0.49
pilB	Acinetobacter baumannii D1279779	54.545	89.796	0.49
pilB	Acinetobacter baylyi ADP1	52.273	89.796	0.469
pilB	Legionella pneumophila strain ERS1305867	50	89.796	0.449
pilF	Thermus thermophilus HB27	52.5	81.633	0.429
pilB/pilB1	Synechocystis sp. PCC 6803	47.619	85.714	0.408
pilB	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	47.5	81.633	0.388