Detailed information
Overview
| Name | pilV | Type | Machinery gene |
| Locus tag | QM552_RS21190 | Genome accession | NZ_OW011623 |
| Coordinates | 1849564..1849743 (-) | Length | 59 a.a. |
| NCBI ID | WP_282809995.1 | Uniprot ID | - |
| Organism | Thauera humireducens strain Piv1 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1846474..1856160 | 1849564..1849743 | within | 0 |
Gene organization within MGE regions
Location: 1846474..1856160
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QM552_RS08330 (C4PIVTH_1738) | - | 1846474..1846773 (-) | 300 | WP_282809991.1 | nucleotidyltransferase domain-containing protein | - |
| QM552_RS08335 (C4PIVTH_1739) | - | 1846853..1847716 (-) | 864 | WP_282809992.1 | hypothetical protein | - |
| QM552_RS08340 (C4PIVTH_1740) | - | 1847716..1848486 (-) | 771 | WP_282809993.1 | hypothetical protein | - |
| QM552_RS08345 (C4PIVTH_1741) | - | 1849096..1849536 (-) | 441 | WP_282809994.1 | hypothetical protein | - |
| QM552_RS21190 (C4PIVTH_1742) | pilV | 1849564..1849743 (-) | 180 | WP_282809995.1 | type IV pilin protein | Machinery gene |
| QM552_RS08355 (C4PIVTH_1743) | - | 1850031..1850231 (-) | 201 | Protein_1647 | hypothetical protein | - |
| QM552_RS08360 (C4PIVTH_1744) | - | 1850245..1850622 (-) | 378 | WP_282809997.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QM552_RS08365 (C4PIVTH_1745) | - | 1850619..1850906 (-) | 288 | WP_004291581.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| QM552_RS08370 (C4PIVTH_1747) | - | 1850982..1851134 (-) | 153 | Protein_1650 | glutathione-disulfide reductase | - |
| QM552_RS21195 | - | 1851174..1851329 (-) | 156 | WP_407084164.1 | HepT-like ribonuclease domain-containing protein | - |
| QM552_RS08375 (C4PIVTH_1748) | - | 1851289..1851561 (-) | 273 | WP_282809998.1 | nucleotidyltransferase family protein | - |
| QM552_RS08380 (C4PIVTH_1749) | gorA | 1851685..1853025 (-) | 1341 | WP_320415432.1 | glutathione-disulfide reductase | - |
| QM552_RS08385 (C4PIVTH_1750) | - | 1853053..1853355 (-) | 303 | WP_282810000.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QM552_RS08390 (C4PIVTH_1751) | - | 1853345..1853590 (-) | 246 | WP_048706619.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| QM552_RS08395 (C4PIVTH_1752) | - | 1853687..1854625 (-) | 939 | WP_282810001.1 | helix-turn-helix transcriptional regulator | - |
| QM552_RS08400 (C4PIVTH_1753) | mobA | 1854633..1855271 (-) | 639 | WP_282810002.1 | molybdenum cofactor guanylyltransferase MobA | - |
| QM552_RS08405 (C4PIVTH_1754) | - | 1855333..1856160 (-) | 828 | WP_282810003.1 | formate dehydrogenase accessory sulfurtransferase FdhD | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6347.54 Da Isoelectric Point: 8.6389
>NTDB_id=1152209 QM552_RS21190 WP_282809995.1 1849564..1849743(-) (pilV) [Thauera humireducens strain Piv1]
MKKIQKGFTLIELMIVVAIIGILAAIAIPQFNEYRAKANDSTAQADAKNGETVLMAAQI
MKKIQKGFTLIELMIVVAIIGILAAIAIPQFNEYRAKANDSTAQADAKNGETVLMAAQI
Nucleotide
Download Length: 180 bp
>NTDB_id=1152209 QM552_RS21190 WP_282809995.1 1849564..1849743(-) (pilV) [Thauera humireducens strain Piv1]
ATGAAAAAGATTCAGAAGGGCTTCACCCTGATCGAACTGATGATCGTCGTGGCGATCATCGGCATCTTGGCTGCCATCGC
GATTCCGCAGTTCAACGAGTATCGCGCCAAGGCGAACGACTCGACTGCTCAAGCGGACGCCAAGAATGGCGAAACCGTGC
TGATGGCCGCACAGATCTAA
ATGAAAAAGATTCAGAAGGGCTTCACCCTGATCGAACTGATGATCGTCGTGGCGATCATCGGCATCTTGGCTGCCATCGC
GATTCCGCAGTTCAACGAGTATCGCGCCAAGGCGAACGACTCGACTGCTCAAGCGGACGCCAAGAATGGCGAAACCGTGC
TGATGGCCGCACAGATCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.