Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   V9W63_RS14685 Genome accession   NZ_CP146760
Coordinates   3013722..3013862 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain JJ334     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3008722..3018862
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V9W63_RS14660 (V9W63_14660) - 3009049..3009432 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  V9W63_RS14665 (V9W63_14665) comA 3009454..3010098 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  V9W63_RS14670 (V9W63_14670) comP 3010179..3012485 (-) 2307 WP_136803669.1 sensor histidine kinase Regulator
  V9W63_RS14675 (V9W63_14675) comX 3012504..3012680 (-) 177 WP_015240484.1 competence pheromone ComX -
  V9W63_RS14680 (V9W63_14680) - 3012695..3013570 (-) 876 WP_025285191.1 polyprenyl synthetase family protein -
  V9W63_RS14685 (V9W63_14685) degQ 3013722..3013862 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  V9W63_RS14690 (V9W63_14690) - 3014328..3014669 (+) 342 WP_007408677.1 hypothetical protein -
  V9W63_RS14695 (V9W63_14695) - 3014676..3015899 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  V9W63_RS14700 (V9W63_14700) - 3016029..3017495 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  V9W63_RS14705 (V9W63_14705) - 3017513..3018064 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  V9W63_RS14710 (V9W63_14710) - 3018161..3018559 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=944332 V9W63_RS14685 WP_003152043.1 3013722..3013862(-) (degQ) [Bacillus velezensis strain JJ334]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=944332 V9W63_RS14685 WP_003152043.1 3013722..3013862(-) (degQ) [Bacillus velezensis strain JJ334]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891