Detailed information
Bioinformatically predicted
Overview
| Name | comEA | Type | Machinery gene |
| Locus tag | KWG61_RS03015 | Genome accession | NZ_CP078088 |
| Coordinates | 495710..495859 (+) | Length | 49 a.a. |
| NCBI ID | WP_242744891.1 | Uniprot ID | - |
| Organism | Allobaculum sp. Allo2 | ||
| Function | dsDNA binding (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 486251..495710 | 495710..495859 | flank | 0 |
Gene organization within MGE regions
Location: 486251..495859
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KWG61_RS16990 | - | 486656..487143 (+) | 488 | Protein_603 | hypothetical protein | - |
| KWG61_RS02955 (KWG61_02795) | - | 487948..488483 (+) | 536 | Protein_604 | recombinase family protein | - |
| KWG61_RS02960 (KWG61_02800) | - | 488904..489062 (+) | 159 | WP_230266467.1 | SLBB domain-containing protein | - |
| KWG61_RS02965 (KWG61_02805) | - | 489436..489816 (+) | 381 | WP_242744883.1 | hypothetical protein | - |
| KWG61_RS02970 (KWG61_02810) | - | 490008..490805 (+) | 798 | WP_242744884.1 | hypothetical protein | - |
| KWG61_RS02975 (KWG61_02815) | - | 490768..491178 (+) | 411 | WP_242744885.1 | hypothetical protein | - |
| KWG61_RS02980 (KWG61_02820) | - | 491196..491687 (+) | 492 | WP_230266470.1 | zinc ribbon domain-containing protein | - |
| KWG61_RS02985 (KWG61_02825) | - | 491690..492103 (+) | 414 | WP_242744886.1 | hypothetical protein | - |
| KWG61_RS02990 (KWG61_02830) | - | 492184..493278 (+) | 1095 | WP_242744887.1 | AAA family ATPase | - |
| KWG61_RS16995 (KWG61_02835) | - | 493224..493373 (+) | 150 | WP_367614247.1 | AAA family ATPase | - |
| KWG61_RS02995 (KWG61_02840) | - | 493399..493683 (+) | 285 | WP_242744888.1 | hypothetical protein | - |
| KWG61_RS03000 (KWG61_02845) | - | 494037..494180 (+) | 144 | WP_242744889.1 | hypothetical protein | - |
| KWG61_RS03005 (KWG61_02850) | - | 494414..495181 (+) | 768 | WP_230266475.1 | hypothetical protein | - |
| KWG61_RS03010 (KWG61_02855) | - | 495366..495710 (+) | 345 | WP_242744890.1 | SLBB domain-containing protein | - |
| KWG61_RS03015 (KWG61_02860) | comEA | 495710..495859 (+) | 150 | WP_242744891.1 | helix-hairpin-helix domain-containing protein | Machinery gene |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5578.53 Da Isoelectric Point: 5.7759
>NTDB_id=586661 KWG61_RS03015 WP_242744891.1 495710..495859(+) (comEA) [Allobaculum sp. Allo2]
MTLPGIGESTAQKILAYREEHGFFKLEDLMEVPGIGEKKFEKLKDRIAL
MTLPGIGESTAQKILAYREEHGFFKLEDLMEVPGIGEKKFEKLKDRIAL
Nucleotide
Download Length: 150 bp
>NTDB_id=586661 KWG61_RS03015 WP_242744891.1 495710..495859(+) (comEA) [Allobaculum sp. Allo2]
ATGACTTTGCCGGGGATCGGCGAATCGACGGCGCAGAAAATTCTGGCGTATCGCGAAGAACATGGCTTTTTCAAACTGGA
AGATCTGATGGAAGTGCCTGGCATTGGCGAAAAGAAGTTTGAAAAGCTGAAGGATCGAATCGCGCTGTGA
ATGACTTTGCCGGGGATCGGCGAATCGACGGCGCAGAAAATTCTGGCGTATCGCGAAGAACATGGCTTTTTCAAACTGGA
AGATCTGATGGAAGTGCCTGGCATTGGCGAAAAGAAGTTTGAAAAGCTGAAGGATCGAATCGCGCTGTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.