Detailed information    

experimental Experimentally validated

Overview


Name   comEA   Type   Machinery gene
Locus tag   TT_RS08100 Genome accession   NC_005835
Coordinates   1516563..1516871 (+) Length   102 a.a.
NCBI ID   WP_024119555.1    Uniprot ID   -
Organism   Thermus thermophilus HB27     
Function   dsDNA binding   
DNA binding and uptake

Function


In addition to the pseudopilus the IM anchored ComEA protein which binds dsDNA is important for the transport of DNA into a DNase-resistant state by pulling the DNA through the OM. The ssDNA is subsequently transported across the IM through a channel formed by the polytopic IM protein ComEC (ComA homologue). Interestingly, ComEC was also found to modulate transcriptional regulation of DNA transporter and T4P components.


Genomic Context


Location: 1511563..1521871
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  TT_RS08070 (TT_C1596) - 1512644..1513108 (+) 465 WP_011173967.1 hypothetical protein -
  TT_RS08075 (TT_C1597) pfkA 1513085..1514053 (-) 969 WP_011173968.1 6-phosphofructokinase -
  TT_RS08080 (TT_C1598) rsmI 1514050..1514844 (-) 795 WP_011173969.1 16S rRNA (cytidine(1402)-2'-O)-methyltransferase -
  TT_RS08085 (TT_C1599) - 1514846..1515340 (-) 495 WP_011173970.1 hypothetical protein -
  TT_RS08090 (TT_C1600) - 1515404..1515931 (-) 528 WP_011173971.1 inorganic diphosphatase -
  TT_RS08095 (TT_C1601) - 1515964..1516590 (+) 627 WP_011173972.1 YcxB family protein -
  TT_RS08100 (TT_C1602) comEA 1516563..1516871 (+) 309 WP_024119555.1 ComEA family DNA-binding protein Machinery gene
  TT_RS08105 (TT_C1603) comA/comEC 1516868..1518901 (+) 2034 WP_011173974.1 ComEC/Rec2 family competence protein Machinery gene
  TT_RS08110 (TT_C1604) spo0J 1518889..1519698 (-) 810 WP_011173975.1 ParB/RepB/Spo0J family partition protein Regulator
  TT_RS08115 (TT_C1605) soj 1519682..1520431 (-) 750 WP_011173976.1 chromosome-partitioning ATPase Soj -
  TT_RS08120 (TT_C1606) rsmG 1520425..1521174 (-) 750 WP_011173977.1 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG -

Sequence


Protein


Download         Length: 102 a.a.        Molecular weight: 10947.23 Da        Isoelectric Point: 10.3435

>NTDB_id=1034 TT_RS08100 WP_024119555.1 1516563..1516871(+) (comEA) [Thermus thermophilus HB27]
MVLGYLLAVALLGLLALWPKLAPAPLPVRVEALGKVAPLPQAQTPVSLNEASLEELMALPGIGPVLARRIVEGRPYARVE
DLLKVKGIGPATLERLRPYLRP

Nucleotide


Download         Length: 309 bp        

>NTDB_id=1034 TT_RS08100 WP_024119555.1 1516563..1516871(+) (comEA) [Thermus thermophilus HB27]
CTGGTCCTCGGCTACCTCCTCGCGGTAGCCCTCCTCGGCCTCCTCGCCCTCTGGCCCAAGCTCGCCCCCGCCCCGCTTCC
GGTGCGGGTGGAGGCCCTGGGAAAGGTCGCCCCTTTGCCCCAGGCGCAAACCCCCGTGAGCCTGAACGAGGCGAGCCTGG
AAGAGCTCATGGCCCTGCCCGGCATCGGCCCCGTCCTGGCCCGGCGCATCGTGGAGGGCAGGCCCTACGCCCGGGTGGAG
GACCTCCTCAAGGTGAAAGGGATCGGCCCCGCCACCCTGGAGCGCCTCCGCCCCTACCTCCGGCCATGA

Domains


Predicted by InterProScan.

(42-101)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comEA Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539

39.815

100

0.422


Multiple sequence alignment    



References


[1] Beate Averhoff et al. (2021) Natural transformation in Gram-negative bacteria thriving in extreme environments: from genes and genomes to proteins, structures and regulation. Extremophiles : Life Under Extreme Conditions 25(5-6):425-436. [PMID: 34542714]
[2] Ralf Salzer et al. (2016) The Thermus thermophilus comEA/comEC operon is associated with DNA binding and regulation of the DNA translocator and type IV pili. Environmental Microbiology 18(1):65-74. [PMID: 25727469]
[3] Cornelia Schwarzenlander et al. (2009) The role of single subunits of the DNA transport machinery of Thermus thermophilus HB27 in DNA binding and transport. Environmental Microbiology 11(4):801-8. [PMID: 19396940]