Detailed information
Overview
| Name | comEA | Type | Machinery gene |
| Locus tag | TT_RS08100 | Genome accession | NC_005835 |
| Coordinates | 1516563..1516871 (+) | Length | 102 a.a. |
| NCBI ID | WP_024119555.1 | Uniprot ID | - |
| Organism | Thermus thermophilus HB27 | ||
| Function | dsDNA binding DNA binding and uptake |
||
Function
In addition to the pseudopilus the IM anchored ComEA protein which binds dsDNA is important for the transport of DNA into a DNase-resistant state by pulling the DNA through the OM. The ssDNA is subsequently transported across the IM through a channel formed by the polytopic IM protein ComEC (ComA homologue). Interestingly, ComEC was also found to modulate transcriptional regulation of DNA transporter and T4P components.
Genomic Context
Location: 1511563..1521871
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| TT_RS08070 (TT_C1596) | - | 1512644..1513108 (+) | 465 | WP_011173967.1 | hypothetical protein | - |
| TT_RS08075 (TT_C1597) | pfkA | 1513085..1514053 (-) | 969 | WP_011173968.1 | 6-phosphofructokinase | - |
| TT_RS08080 (TT_C1598) | rsmI | 1514050..1514844 (-) | 795 | WP_011173969.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| TT_RS08085 (TT_C1599) | - | 1514846..1515340 (-) | 495 | WP_011173970.1 | hypothetical protein | - |
| TT_RS08090 (TT_C1600) | - | 1515404..1515931 (-) | 528 | WP_011173971.1 | inorganic diphosphatase | - |
| TT_RS08095 (TT_C1601) | - | 1515964..1516590 (+) | 627 | WP_011173972.1 | YcxB family protein | - |
| TT_RS08100 (TT_C1602) | comEA | 1516563..1516871 (+) | 309 | WP_024119555.1 | ComEA family DNA-binding protein | Machinery gene |
| TT_RS08105 (TT_C1603) | comA/comEC | 1516868..1518901 (+) | 2034 | WP_011173974.1 | ComEC/Rec2 family competence protein | Machinery gene |
| TT_RS08110 (TT_C1604) | - | 1518889..1519698 (-) | 810 | WP_011173975.1 | ParB/RepB/Spo0J family partition protein | - |
| TT_RS08115 (TT_C1605) | soj | 1519682..1520431 (-) | 750 | WP_011173976.1 | chromosome-partitioning ATPase Soj | - |
| TT_RS08120 (TT_C1606) | rsmG | 1520425..1521174 (-) | 750 | WP_011173977.1 | 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG | - |
Sequence
Protein
Download Length: 102 a.a. Molecular weight: 10947.23 Da Isoelectric Point: 10.3435
MVLGYLLAVALLGLLALWPKLAPAPLPVRVEALGKVAPLPQAQTPVSLNEASLEELMALPGIGPVLARRIVEGRPYARVE
DLLKVKGIGPATLERLRPYLRP
Nucleotide
Download Length: 309 bp
CTGGTCCTCGGCTACCTCCTCGCGGTAGCCCTCCTCGGCCTCCTCGCCCTCTGGCCCAAGCTCGCCCCCGCCCCGCTTCC
GGTGCGGGTGGAGGCCCTGGGAAAGGTCGCCCCTTTGCCCCAGGCGCAAACCCCCGTGAGCCTGAACGAGGCGAGCCTGG
AAGAGCTCATGGCCCTGCCCGGCATCGGCCCCGTCCTGGCCCGGCGCATCGTGGAGGGCAGGCCCTACGCCCGGGTGGAG
GACCTCCTCAAGGTGAAAGGGATCGGCCCCGCCACCCTGGAGCGCCTCCGCCCCTACCTCCGGCCATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comEA | Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539 |
39.815 |
100 |
0.422 |
Multiple sequence alignment
References
| [1] | Beate Averhoff et al. (2021) Natural transformation in Gram-negative bacteria thriving in extreme environments: from genes and genomes to proteins, structures and regulation. Extremophiles : Life Under Extreme Conditions 25(5-6):425-436. [PMID: 34542714] |
| [2] | Ralf Salzer et al. (2016) The Thermus thermophilus comEA/comEC operon is associated with DNA binding and regulation of the DNA translocator and type IV pili. Environmental Microbiology 18(1):65-74. [PMID: 25727469] |
| [3] | Cornelia Schwarzenlander et al. (2009) The role of single subunits of the DNA transport machinery of Thermus thermophilus HB27 in DNA binding and transport. Environmental Microbiology 11(4):801-8. [PMID: 19396940] |