Detailed information
Bioinformatically predicted
Overview
| Name | comEA | Type | Machinery gene |
| Locus tag | M5M_RS02545 | Genome accession | NC_018868 |
| Coordinates | 567891..568100 (+) | Length | 69 a.a. |
| NCBI ID | WP_016389179.1 | Uniprot ID | - |
| Organism | Simiduia agarivorans SA1 = DSM 21679 | ||
| Function | dsDNA binding (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 562818..608745 | 567891..568100 | within | 0 |
Gene organization within MGE regions
Location: 562818..608745
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5M_RS02530 (M5M_02530) | - | 562818..565040 (+) | 2223 | WP_016389178.1 | bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase | - |
| M5M_RS02535 (M5M_02535) | - | 565087..566442 (+) | 1356 | WP_015045899.1 | phosphomannomutase/phosphoglucomutase | - |
| M5M_RS02540 (M5M_02540) | galU | 566590..567468 (+) | 879 | WP_015045900.1 | UTP--glucose-1-phosphate uridylyltransferase GalU | - |
| M5M_RS02545 (M5M_02545) | comEA | 567891..568100 (+) | 210 | WP_016389179.1 | ComEA family DNA-binding protein | Machinery gene |
| M5M_RS02550 (M5M_02550) | cmk | 568381..569052 (+) | 672 | WP_015045902.1 | (d)CMP kinase | - |
| M5M_RS02560 (M5M_02560) | rpsA | 569222..570904 (+) | 1683 | WP_015045904.1 | 30S ribosomal protein S1 | - |
| M5M_RS02565 (M5M_02565) | ihfB | 571230..571526 (+) | 297 | WP_015045905.1 | integration host factor subunit beta | - |
| M5M_RS02570 (M5M_02570) | - | 571535..571807 (+) | 273 | WP_015045906.1 | LapA family protein | - |
| M5M_RS02575 (M5M_02575) | - | 571815..572996 (+) | 1182 | WP_015045907.1 | tetratricopeptide repeat protein | - |
| M5M_RS02580 (M5M_02580) | pyrF | 573217..573921 (+) | 705 | WP_024330264.1 | orotidine-5'-phosphate decarboxylase | - |
| M5M_RS02585 (M5M_02585) | cysD | 574175..575086 (+) | 912 | WP_015045909.1 | sulfate adenylyltransferase subunit CysD | - |
| M5M_RS02590 (M5M_02590) | cysN | 575181..576599 (+) | 1419 | WP_015045910.1 | sulfate adenylyltransferase subunit CysN | - |
| M5M_RS02595 (M5M_02595) | - | 576669..578411 (+) | 1743 | WP_162141154.1 | glycosyltransferase family 2 protein | - |
| M5M_RS02600 (M5M_02600) | - | 578457..579338 (+) | 882 | WP_162141153.1 | glycosyltransferase | - |
| M5M_RS02605 (M5M_02605) | - | 579341..580204 (+) | 864 | WP_015045913.1 | glycosyltransferase family 2 protein | - |
| M5M_RS02610 (M5M_02610) | - | 580234..580755 (+) | 522 | WP_015045914.1 | hypothetical protein | - |
| M5M_RS02615 (M5M_02617) | - | 580807..581613 (+) | 807 | WP_016389181.1 | ABC transporter permease | - |
| M5M_RS02620 (M5M_02625) | - | 581610..582338 (+) | 729 | WP_015045915.1 | ABC transporter ATP-binding protein | - |
| M5M_RS02625 (M5M_02630) | - | 582406..583812 (+) | 1407 | WP_015045916.1 | hypothetical protein | - |
| M5M_RS02630 (M5M_02635) | - | 583951..585084 (+) | 1134 | WP_015045917.1 | hypothetical protein | - |
| M5M_RS19280 (M5M_02640) | - | 585087..586355 (+) | 1269 | WP_015045918.1 | FkbM family methyltransferase | - |
| M5M_RS02640 (M5M_02645) | - | 586425..587642 (+) | 1218 | WP_024330260.1 | exostosin domain-containing protein | - |
| M5M_RS02645 (M5M_02650) | - | 587639..588664 (+) | 1026 | WP_015045920.1 | hypothetical protein | - |
| M5M_RS02650 (M5M_02655) | - | 588677..589678 (+) | 1002 | WP_016389182.1 | GSCFA domain-containing protein | - |
| M5M_RS02655 (M5M_02660) | - | 589656..590693 (+) | 1038 | WP_144062370.1 | hypothetical protein | - |
| M5M_RS02660 (M5M_02665) | gmd | 590761..591876 (+) | 1116 | WP_015045923.1 | GDP-mannose 4,6-dehydratase | - |
| M5M_RS02665 (M5M_02670) | fcl | 591932..592891 (+) | 960 | WP_016389183.1 | GDP-L-fucose synthase | - |
| M5M_RS02670 (M5M_02675) | - | 592897..593352 (+) | 456 | WP_015045925.1 | GDP-mannose mannosyl hydrolase | - |
| M5M_RS02675 (M5M_02680) | - | 593354..594763 (+) | 1410 | WP_015045926.1 | mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | - |
| M5M_RS02680 (M5M_02685) | - | 594776..595663 (+) | 888 | WP_015045927.1 | hypothetical protein | - |
| M5M_RS02685 (M5M_02690) | - | 595792..596685 (+) | 894 | WP_015045928.1 | glycosyltransferase family 10 domain-containing protein | - |
| M5M_RS02690 (M5M_02695) | - | 596733..597899 (+) | 1167 | WP_015045929.1 | nucleotide sugar dehydrogenase | - |
| M5M_RS02695 (M5M_02700) | rfbB | 598026..599039 (+) | 1014 | WP_015045930.1 | dTDP-glucose 4,6-dehydratase | - |
| M5M_RS02700 (M5M_02705) | rfbA | 599041..599913 (+) | 873 | WP_015045931.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| M5M_RS02705 (M5M_02710) | rfbC | 599925..600473 (+) | 549 | WP_015045932.1 | dTDP-4-dehydrorhamnose 3,5-epimerase | - |
| M5M_RS19285 (M5M_02715) | - | 600445..603315 (+) | 2871 | WP_144062371.1 | glycosyltransferase | - |
| M5M_RS02715 (M5M_02720) | - | 603328..604275 (+) | 948 | WP_081640091.1 | sulfotransferase family 2 domain-containing protein | - |
| M5M_RS02720 (M5M_02725) | - | 604299..606251 (-) | 1953 | WP_081640092.1 | polysaccharide biosynthesis protein | - |
| M5M_RS02725 (M5M_02730) | - | 606205..607218 (-) | 1014 | WP_015045936.1 | MraY family glycosyltransferase | - |
| M5M_RS02730 (M5M_02735) | - | 607212..608150 (-) | 939 | WP_015045937.1 | NAD-dependent epimerase/dehydratase family protein | - |
| M5M_RS02735 (M5M_02740) | - | 608305..608745 (+) | 441 | WP_015045938.1 | REP-associated tyrosine transposase | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 7291.35 Da Isoelectric Point: 9.8677
>NTDB_id=54078 M5M_RS02545 WP_016389179.1 567891..568100(+) (comEA) [Simiduia agarivorans SA1 = DSM 21679]
MAQTSTVNINTASAEELSASLKGIGTSKAQAIVDYREKVGKFVSIDQLAEVKGIGAATVEKNRALIRLQ
MAQTSTVNINTASAEELSASLKGIGTSKAQAIVDYREKVGKFVSIDQLAEVKGIGAATVEKNRALIRLQ
Nucleotide
Download Length: 210 bp
>NTDB_id=54078 M5M_RS02545 WP_016389179.1 567891..568100(+) (comEA) [Simiduia agarivorans SA1 = DSM 21679]
GTGGCACAGACCTCTACTGTAAATATCAACACCGCCAGCGCGGAGGAGTTGTCGGCCTCCCTTAAGGGGATTGGCACATC
TAAAGCGCAAGCCATTGTAGATTACCGGGAAAAGGTGGGTAAGTTTGTCTCCATCGATCAGCTTGCTGAAGTTAAGGGTA
TAGGCGCTGCCACGGTTGAAAAAAACCGCGCGCTTATCCGGCTGCAGTAA
GTGGCACAGACCTCTACTGTAAATATCAACACCGCCAGCGCGGAGGAGTTGTCGGCCTCCCTTAAGGGGATTGGCACATC
TAAAGCGCAAGCCATTGTAGATTACCGGGAAAAGGTGGGTAAGTTTGTCTCCATCGATCAGCTTGCTGAAGTTAAGGGTA
TAGGCGCTGCCACGGTTGAAAAAAACCGCGCGCTTATCCGGCTGCAGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.