Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | IAR44_RS19835 | Genome accession | NZ_CP061087 |
| Coordinates | 4051570..4052088 (-) | Length | 172 a.a. |
| NCBI ID | WP_004392979.1 | Uniprot ID | A0A9Q3LJE1 |
| Organism | Bacillus velezensis strain CLA178 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 4005274..4066293 | 4051570..4052088 | within | 0 |
Gene organization within MGE regions
Location: 4005274..4066293
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IAR44_RS19575 (IAR44_19575) | - | 4006679..4008223 (+) | 1545 | WP_077392043.1 | glycoside hydrolase family 32 protein | - |
| IAR44_RS19580 (IAR44_19580) | - | 4008303..4008965 (+) | 663 | WP_064115189.1 | GntR family transcriptional regulator | - |
| IAR44_RS19585 (IAR44_19585) | - | 4009043..4009552 (-) | 510 | WP_077392042.1 | DinB family protein | - |
| IAR44_RS19590 (IAR44_19590) | - | 4009605..4010822 (-) | 1218 | WP_077392041.1 | MFS transporter | - |
| IAR44_RS19595 (IAR44_19595) | - | 4010988..4011860 (-) | 873 | WP_031379208.1 | LysR family transcriptional regulator | - |
| IAR44_RS19600 (IAR44_19600) | - | 4011987..4012565 (+) | 579 | WP_012118916.1 | LysE family translocator | - |
| IAR44_RS19605 (IAR44_19605) | - | 4012649..4013017 (-) | 369 | WP_039063879.1 | DUF1304 domain-containing protein | - |
| IAR44_RS19610 (IAR44_19610) | - | 4013048..4013686 (-) | 639 | WP_004393039.1 | nitroreductase family protein | - |
| IAR44_RS19615 (IAR44_19615) | - | 4013700..4014134 (-) | 435 | WP_032875377.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| IAR44_RS19620 (IAR44_19620) | - | 4014273..4015151 (-) | 879 | WP_015387425.1 | YitT family protein | - |
| IAR44_RS19625 (IAR44_19625) | - | 4015334..4015786 (-) | 453 | WP_007615031.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| IAR44_RS19630 (IAR44_19630) | - | 4015907..4016338 (+) | 432 | WP_061861071.1 | GNAT family N-acetyltransferase | - |
| IAR44_RS19635 (IAR44_19635) | - | 4016698..4017564 (+) | 867 | WP_061861072.1 | DUF1259 domain-containing protein | - |
| IAR44_RS19640 (IAR44_19640) | - | 4017775..4018176 (-) | 402 | WP_007409882.1 | carboxymuconolactone decarboxylase family protein | - |
| IAR44_RS19645 (IAR44_19645) | - | 4018281..4019189 (-) | 909 | WP_032875365.1 | LysR family transcriptional regulator | - |
| IAR44_RS19650 (IAR44_19650) | - | 4019308..4020093 (+) | 786 | WP_007409884.1 | 3-hydroxybutyrate dehydrogenase | - |
| IAR44_RS19655 (IAR44_19655) | - | 4020347..4021795 (-) | 1449 | WP_015418637.1 | PLP-dependent aminotransferase family protein | - |
| IAR44_RS19660 (IAR44_19660) | - | 4021924..4022835 (+) | 912 | WP_061861073.1 | DMT family transporter | - |
| IAR44_RS19665 (IAR44_19665) | - | 4022985..4023164 (+) | 180 | Protein_3857 | DUF255 domain-containing protein | - |
| IAR44_RS19670 (IAR44_19670) | - | 4023242..4024750 (+) | 1509 | WP_099320015.1 | recombinase family protein | - |
| IAR44_RS19675 (IAR44_19675) | - | 4024857..4026050 (-) | 1194 | WP_099320016.1 | Rap family tetratricopeptide repeat protein | - |
| IAR44_RS19680 (IAR44_19680) | - | 4026487..4027314 (-) | 828 | WP_099320017.1 | hypothetical protein | - |
| IAR44_RS19685 (IAR44_19685) | - | 4027561..4027947 (-) | 387 | WP_099320018.1 | cystatin-like fold lipoprotein | - |
| IAR44_RS19690 (IAR44_19690) | - | 4028010..4028516 (-) | 507 | WP_099320019.1 | hypothetical protein | - |
| IAR44_RS19695 (IAR44_19695) | - | 4028528..4029538 (-) | 1011 | WP_099320020.1 | bifunctional lytic transglycosylase/C40 family peptidase | - |
| IAR44_RS19700 (IAR44_19700) | - | 4029535..4031904 (-) | 2370 | WP_099320021.1 | CD3337/EF1877 family mobilome membrane protein | - |
| IAR44_RS19705 (IAR44_19705) | - | 4031915..4032241 (-) | 327 | WP_017418466.1 | YddF family protein | - |
| IAR44_RS19710 (IAR44_19710) | - | 4032255..4034750 (-) | 2496 | WP_124737108.1 | ATP-binding protein | - |
| IAR44_RS19715 (IAR44_19715) | - | 4034638..4035162 (-) | 525 | WP_039062660.1 | conjugal transfer protein | - |
| IAR44_RS19720 (IAR44_19720) | - | 4035174..4035422 (-) | 249 | WP_025649948.1 | hypothetical protein | - |
| IAR44_RS19725 (IAR44_19725) | - | 4035438..4036502 (-) | 1065 | WP_099320022.1 | conjugal transfer protein | - |
| IAR44_RS19730 (IAR44_19730) | - | 4036661..4036957 (-) | 297 | WP_099320108.1 | hypothetical protein | - |
| IAR44_RS19735 (IAR44_19735) | - | 4037025..4037312 (-) | 288 | WP_039062656.1 | hypothetical protein | - |
| IAR44_RS19740 (IAR44_19740) | - | 4037334..4037588 (-) | 255 | WP_025649953.1 | DUF3850 domain-containing protein | - |
| IAR44_RS19745 (IAR44_19745) | - | 4037864..4038922 (-) | 1059 | WP_099320023.1 | replication initiation factor domain-containing protein | - |
| IAR44_RS19750 (IAR44_19750) | - | 4038915..4040336 (-) | 1422 | WP_099320109.1 | DNA translocase FtsK | - |
| IAR44_RS19755 (IAR44_19755) | - | 4040522..4040896 (-) | 375 | WP_099320024.1 | YdcP family protein | - |
| IAR44_RS20305 | - | 4040961..4041052 (-) | 92 | Protein_3876 | hypothetical protein | - |
| IAR44_RS19760 (IAR44_19760) | - | 4041258..4041518 (-) | 261 | WP_099320025.1 | hypothetical protein | - |
| IAR44_RS19765 (IAR44_19765) | - | 4041569..4041829 (-) | 261 | WP_099320026.1 | hypothetical protein | - |
| IAR44_RS19770 (IAR44_19770) | - | 4041826..4041996 (-) | 171 | WP_394810743.1 | ICEBs1 excisionase | - |
| IAR44_RS19775 (IAR44_19775) | - | 4042292..4042672 (+) | 381 | WP_099320028.1 | helix-turn-helix domain-containing protein | - |
| IAR44_RS19780 (IAR44_19780) | - | 4042669..4043178 (+) | 510 | WP_099320029.1 | ImmA/IrrE family metallo-endopeptidase | - |
| IAR44_RS19785 (IAR44_19785) | - | 4043215..4043370 (+) | 156 | Protein_3882 | DUF255 domain-containing protein | - |
| IAR44_RS19790 (IAR44_19790) | - | 4043406..4045295 (+) | 1890 | WP_187954879.1 | thioredoxin domain-containing protein | - |
| IAR44_RS19795 (IAR44_19795) | - | 4045292..4046188 (-) | 897 | WP_053573843.1 | CPBP family intramembrane glutamic endopeptidase | - |
| IAR44_RS19800 (IAR44_19800) | - | 4046402..4047733 (+) | 1332 | WP_061861075.1 | MFS transporter | - |
| IAR44_RS19805 (IAR44_19805) | - | 4047766..4048146 (-) | 381 | WP_039253120.1 | VOC family protein | - |
| IAR44_RS19810 (IAR44_19810) | - | 4048203..4049141 (-) | 939 | WP_061861076.1 | LacI family DNA-binding transcriptional regulator | - |
| IAR44_RS19815 (IAR44_19815) | xth | 4049204..4049962 (-) | 759 | WP_033574264.1 | exodeoxyribonuclease III | - |
| IAR44_RS19820 (IAR44_19820) | - | 4049959..4050516 (-) | 558 | WP_061861077.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
| IAR44_RS19825 (IAR44_19825) | - | 4050513..4051094 (-) | 582 | WP_039253109.1 | bifunctional transcriptional activator/DNA repair enzyme AdaA | - |
| IAR44_RS19830 (IAR44_19830) | rpsR | 4051287..4051526 (-) | 240 | WP_004392983.1 | 30S ribosomal protein S18 | - |
| IAR44_RS19835 (IAR44_19835) | ssbA | 4051570..4052088 (-) | 519 | WP_004392979.1 | single-stranded DNA-binding protein SsbA | Machinery gene |
| IAR44_RS19840 (IAR44_19840) | rpsF | 4052128..4052415 (-) | 288 | WP_004392977.1 | 30S ribosomal protein S6 | - |
| IAR44_RS19845 (IAR44_19845) | ychF | 4052527..4053627 (-) | 1101 | WP_004392975.1 | redox-regulated ATPase YchF | - |
| IAR44_RS19850 (IAR44_19850) | - | 4053754..4055757 (-) | 2004 | WP_060673742.1 | molybdopterin-dependent oxidoreductase | - |
| IAR44_RS19855 (IAR44_19855) | - | 4055804..4056010 (-) | 207 | WP_004392973.1 | DUF951 domain-containing protein | - |
| IAR44_RS19860 (IAR44_19860) | - | 4056096..4057121 (-) | 1026 | WP_088005468.1 | hypothetical protein | - |
| IAR44_RS19865 (IAR44_19865) | - | 4057265..4057768 (+) | 504 | WP_077392039.1 | GNAT family N-acetyltransferase | - |
| IAR44_RS19870 (IAR44_19870) | yyaC | 4057943..4058557 (+) | 615 | WP_004392969.1 | spore protease YyaC | - |
| IAR44_RS19875 (IAR44_19875) | - | 4058587..4059438 (-) | 852 | WP_004392966.1 | ParB/RepB/Spo0J family partition protein | - |
| IAR44_RS19880 (IAR44_19880) | soj | 4059431..4060192 (-) | 762 | WP_007409899.1 | sporulation initiation inhibitor protein Soj | - |
| IAR44_RS19885 (IAR44_19885) | noc | 4060492..4061343 (-) | 852 | WP_007409900.1 | nucleoid occlusion protein | - |
| IAR44_RS19890 (IAR44_19890) | rsmG | 4061465..4062184 (-) | 720 | WP_007409901.1 | 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG | - |
| IAR44_RS19895 (IAR44_19895) | mnmG | 4062198..4064084 (-) | 1887 | WP_061861078.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG | - |
| IAR44_RS19900 (IAR44_19900) | mnmE | 4064101..4065480 (-) | 1380 | WP_077392038.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE | - |
Sequence
Protein
Download Length: 172 a.a. Molecular weight: 18745.31 Da Isoelectric Point: 4.7621
>NTDB_id=480586 IAR44_RS19835 WP_004392979.1 4051570..4052088(-) (ssbA) [Bacillus velezensis strain CLA178]
MLNRVVLVGRLTKDPELRYTPSGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTR
NYENQQGQRVFVTEVQAESVQFLEPKNSGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQRRNQGNSFNDDPFANDG
KPIDISDDDLPF
MLNRVVLVGRLTKDPELRYTPSGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTR
NYENQQGQRVFVTEVQAESVQFLEPKNSGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQRRNQGNSFNDDPFANDG
KPIDISDDDLPF
Nucleotide
Download Length: 519 bp
>NTDB_id=480586 IAR44_RS19835 WP_004392979.1 4051570..4052088(-) (ssbA) [Bacillus velezensis strain CLA178]
ATGCTTAACCGAGTTGTATTAGTCGGAAGACTGACAAAAGACCCAGAGCTTCGTTATACGCCAAGCGGTGCGGCTGTCGC
CACGTTTACTCTTGCTGTGAATCGTACATTCACGAACCAGTCCGGAGAACGTGAAGCCGATTTCATTAATTGTGTCACTT
GGAGAAGACAAGCCGAAAACGTTGCAAACTTTCTTAAAAAAGGAAGCCTTGCCGGCGTAGACGGCCGACTCCAGACAAGA
AATTATGAAAACCAGCAGGGACAGCGTGTCTTCGTGACAGAAGTCCAAGCTGAAAGTGTTCAATTTCTTGAGCCTAAAAA
CAGCGGCGGTTCTGGATCAGGCGGATACAACGAAGGAAACAGCGGCGGAGGCCAATACTTTGGCGGAGGCCAAAATGATA
ATCCGTTCGGCGGAAATCAGAACAACCAGAGACGAAATCAAGGGAACAGCTTTAATGATGATCCATTTGCCAACGACGGC
AAGCCGATTGACATCTCGGATGATGATCTTCCGTTCTAA
ATGCTTAACCGAGTTGTATTAGTCGGAAGACTGACAAAAGACCCAGAGCTTCGTTATACGCCAAGCGGTGCGGCTGTCGC
CACGTTTACTCTTGCTGTGAATCGTACATTCACGAACCAGTCCGGAGAACGTGAAGCCGATTTCATTAATTGTGTCACTT
GGAGAAGACAAGCCGAAAACGTTGCAAACTTTCTTAAAAAAGGAAGCCTTGCCGGCGTAGACGGCCGACTCCAGACAAGA
AATTATGAAAACCAGCAGGGACAGCGTGTCTTCGTGACAGAAGTCCAAGCTGAAAGTGTTCAATTTCTTGAGCCTAAAAA
CAGCGGCGGTTCTGGATCAGGCGGATACAACGAAGGAAACAGCGGCGGAGGCCAATACTTTGGCGGAGGCCAAAATGATA
ATCCGTTCGGCGGAAATCAGAACAACCAGAGACGAAATCAAGGGAACAGCTTTAATGATGATCCATTTGCCAACGACGGC
AAGCCGATTGACATCTCGGATGATGATCTTCCGTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
98.837 |
100 |
0.988 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.757 |
100 |
0.605 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
64.151 |
61.628 |
0.395 |
| ssb | Glaesserella parasuis strain SC1401 |
35.519 |
100 |
0.378 |