Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   R2866_RS03040 Genome accession   NC_017451
Coordinates   600275..600697 (-) Length   140 a.a.
NCBI ID   WP_005687556.1    Uniprot ID   A0A377IYS1
Organism   Haemophilus influenzae R2866     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 555218..608397 600275..600697 within 0


Gene organization within MGE regions


Location: 555218..608397
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R2866_RS02785 (R2866_0555) - 555599..556375 (+) 777 WP_005653466.1 hypothetical protein -
  R2866_RS02790 (R2866_0556) - 556370..557182 (-) 813 WP_005653468.1 tyrosine-type recombinase/integrase -
  R2866_RS02795 (R2866_0557) mobH 557273..559180 (-) 1908 WP_020910023.1 MobH family relaxase -
  R2866_RS02800 (R2866_0558) - 559417..560121 (+) 705 WP_020910024.1 phosphoribosyltransferase -
  R2866_RS02805 (R2866_0559) - 560437..561135 (-) 699 WP_012564949.1 helix-turn-helix domain-containing protein -
  R2866_RS02810 (R2866_0560) - 561425..561742 (-) 318 WP_012564948.1 hypothetical protein -
  R2866_RS02815 (R2866_0561) - 561961..562152 (+) 192 WP_005653495.1 hypothetical protein -
  R2866_RS02820 (R2866_0562) - 562167..562757 (+) 591 WP_020910025.1 recombinase family protein -
  R2866_RS02825 (R2866_0563) - 562840..563283 (+) 444 WP_020910026.1 hypothetical protein -
  R2866_RS02830 (R2866_0564) - 563360..564121 (-) 762 WP_020910027.1 N-6 DNA methylase -
  R2866_RS02835 (R2866_0565) - 564225..565178 (-) 954 WP_020910028.1 ArdC family protein -
  R2866_RS09950 (R2866_0566) - 565309..565467 (-) 159 WP_005667862.1 hypothetical protein -
  R2866_RS02840 (R2866_0567) - 565471..565668 (-) 198 WP_015701374.1 hypothetical protein -
  R2866_RS02845 (R2866_0568) - 565722..565955 (-) 234 WP_005653503.1 hypothetical protein -
  R2866_RS02850 (R2866_0569) - 566040..566402 (-) 363 WP_020910029.1 hypothetical protein -
  R2866_RS02855 (R2866_0570) - 566777..567214 (+) 438 WP_020910030.1 TIGR03757 family integrating conjugative element protein -
  R2866_RS02860 (R2866_0571) - 567211..568152 (+) 942 WP_005687598.1 TIGR03756 family integrating conjugative element protein -
  R2866_RS02865 (R2866_0572) - 568167..570167 (+) 2001 WP_005687597.1 integrating conjugative element protein -
  R2866_RS02870 (R2866_0573) - 570183..570590 (+) 408 WP_005667853.1 hypothetical protein -
  R2866_RS02875 - 570635..570814 (-) 180 WP_005667851.1 hypothetical protein -
  R2866_RS02880 (R2866_0574) - 571038..571898 (-) 861 WP_000027057.1 broad-spectrum class A beta-lactamase TEM-1 -
  R2866_RS02885 (R2866_0575) - 571946..572503 (-) 558 WP_001235713.1 recombinase family protein -
  R2866_RS02890 (R2866_0576) - 572667..575672 (+) 3006 WP_001143760.1 Tn3-like element Tn3 family transposase -
  R2866_RS02895 (R2866_0577) - 575830..576159 (+) 330 WP_005667844.1 hypothetical protein -
  R2866_RS02900 (R2866_0578) - 576215..577708 (-) 1494 WP_011271852.1 conjugal transfer protein TraG N-terminal domain-containing protein -
  R2866_RS02905 (R2866_0579) - 577717..578040 (-) 324 WP_011271851.1 hypothetical protein -
  R2866_RS02910 (R2866_0580) - 578050..578493 (-) 444 WP_005687593.1 hypothetical protein -
  R2866_RS02915 (R2866_0581) - 578465..581335 (-) 2871 WP_011271849.1 conjugative transfer ATPase -
  R2866_RS02920 (R2866_0582) - 581351..581758 (-) 408 WP_011271848.1 TIGR03751 family conjugal transfer lipoprotein -
  R2866_RS02925 (R2866_0583) - 581768..583168 (-) 1401 WP_011271847.1 TIGR03752 family integrating conjugative element protein -
  R2866_RS02930 (R2866_0584) - 583179..584048 (-) 870 WP_011271846.1 TIGR03749 family integrating conjugative element protein -
  R2866_RS02935 (R2866_0585) - 584048..584692 (-) 645 WP_011271845.1 PFL_4703 family integrating conjugative element protein -
  R2866_RS02940 (R2866_0586) - 584704..585075 (-) 372 WP_011271844.1 TIGR03750 family conjugal transfer protein -
  R2866_RS02945 (R2866_0587) - 585095..585496 (-) 402 WP_005687585.1 DUF2976 domain-containing protein -
  R2866_RS02950 (R2866_0588) - 585516..585761 (-) 246 WP_005687584.1 DUF3262 family protein -
  R2866_RS02955 (R2866_0589) - 585765..586085 (-) 321 WP_005687583.1 RAQPRD family integrative conjugative element protein -
  R2866_RS02960 (R2866_0590) - 586246..586932 (-) 687 WP_005687582.1 TIGR03747 family integrating conjugative element membrane protein -
  R2866_RS02965 (R2866_0591) - 586932..587267 (-) 336 WP_005687581.1 hypothetical protein -
  R2866_RS02970 (R2866_0592) traD 587251..589500 (-) 2250 WP_011271842.1 type IV conjugative transfer system coupling protein TraD -
  R2866_RS02975 (R2866_0593) - 589497..590003 (-) 507 WP_011271841.1 integrating conjugative element protein -
  R2866_RS02980 (R2866_0594) - 590019..590777 (-) 759 WP_011271840.1 transglycosylase SLT domain-containing protein -
  R2866_RS02985 (R2866_0595) - 590756..591496 (-) 741 WP_011271839.1 TIGR03759 family integrating conjugative element protein -
  R2866_RS02990 (R2866_0596) - 591500..592129 (-) 630 WP_011271838.1 lipoprotein -
  R2866_RS02995 (R2866_0597) - 592228..592992 (-) 765 WP_011271837.1 TraX family protein -
  R2866_RS09515 (R2866_0598) - 593050..593646 (-) 597 WP_011271836.1 hypothetical protein -
  R2866_RS03005 (R2866_0599) radC 593739..594209 (-) 471 WP_011271835.1 RadC family protein -
  R2866_RS03010 (R2866_0600) - 594310..594717 (-) 408 WP_011271834.1 hypothetical protein -
  R2866_RS03015 (R2866_0601) - 594752..595393 (-) 642 WP_011271833.1 DUF3560 domain-containing protein -
  R2866_RS03020 (R2866_0602) - 595508..595936 (-) 429 WP_011271832.1 STY4534 family ICE replication protein -
  R2866_RS03025 (R2866_0603) - 596821..598866 (-) 2046 WP_014326561.1 DNA topoisomerase III -
  R2866_RS03030 (R2866_0604) - 598957..599514 (+) 558 WP_011271830.1 plasmid fertility inhibition factor family protein -
  R2866_RS03035 (R2866_0605) - 599730..600248 (-) 519 WP_005687559.1 membrane lipoprotein lipid attachment site-containing protein -
  R2866_RS03040 (R2866_0606) ssb 600275..600697 (-) 423 WP_005687556.1 single-stranded DNA-binding protein Machinery gene
  R2866_RS03045 (R2866_0607) - 600943..601416 (-) 474 WP_005653583.1 DUF3158 family protein -
  R2866_RS03050 (R2866_0608) - 601431..602186 (-) 756 WP_005667775.1 PFL_4669 family integrating conjugative element protein -
  R2866_RS03060 (R2866_0609) - 602447..603670 (-) 1224 WP_011271828.1 STY4528 family pathogenicity island replication protein -
  R2866_RS03065 (R2866_0610) - 603820..604371 (-) 552 WP_005653590.1 DUF2857 domain-containing protein -
  R2866_RS03070 (R2866_0611) - 604371..606071 (-) 1701 WP_011271827.1 ParB family protein -
  R2866_RS03075 (R2866_0612) dnaB 606064..607419 (-) 1356 WP_011271826.1 replicative DNA helicase -
  R2866_RS03080 (R2866_0613) - 607421..608257 (-) 837 WP_011271825.1 ParA family protein -

Sequence


Protein


Download         Length: 140 a.a.        Molecular weight: 15716.54 Da        Isoelectric Point: 5.7558

>NTDB_id=47263 R2866_RS03040 WP_005687556.1 600275..600697(-) (ssb) [Haemophilus influenzae R2866]
MAGINKVIIVGHLGNDPEMRSMPNGEAVANISVATSEAWTDKNTGERREVTEWHRIVFYRKLAEICGQYLKKGAQVYIEG
RLRTRKWQDQNGQDRYTTEIQGDVMQMLGTRPQSADGANNSQPMPQQDASANAFDDSIPF

Nucleotide


Download         Length: 423 bp        

>NTDB_id=47263 R2866_RS03040 WP_005687556.1 600275..600697(-) (ssb) [Haemophilus influenzae R2866]
ATGGCTGGAATTAATAAAGTAATTATCGTGGGACATTTAGGTAATGATCCTGAAATGCGAAGCATGCCGAATGGTGAAGC
AGTTGCAAATATCAGTGTAGCAACTAGCGAAGCTTGGACGGATAAAAACACCGGTGAACGTCGTGAAGTGACTGAATGGC
ATCGAATCGTTTTTTATCGCAAATTAGCTGAAATTTGCGGCCAATATCTCAAGAAAGGAGCGCAAGTTTATATTGAAGGA
CGCTTGCGTACTCGTAAATGGCAAGATCAAAACGGGCAAGATCGTTATACCACGGAAATCCAAGGTGATGTAATGCAAAT
GTTAGGTACTCGCCCTCAAAGTGCAGATGGTGCAAATAATTCTCAGCCAATGCCACAACAAGATGCATCGGCAAATGCTT
TTGATGATTCAATACCATTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A377IYS1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

56.111

100

0.721

  ssb Vibrio cholerae strain A1552

52.023

100

0.643

  ssb Neisseria meningitidis MC58

59.13

82.143

0.486

  ssb Neisseria gonorrhoeae MS11

59.13

82.143

0.486


Multiple sequence alignment