Detailed information NTG0315721

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: D3880_RS23220
• Genome accession: NZ_CP032419
• Coordinates: 4146271..4146456 (-)
• Length: 61 a.a.
• NCBI ID: WP_119894952.1
• Uniprot ID: A0A385Z4R4
• Organism: Pseudomonas cavernae strain K2W31S-8
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 4141271..4151456

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
D3880_RS18825 (D3880_18830)	nadC	4141943..4142791 (+)	849	WP_119894949.1	carboxylating nicotinate-nucleotide diphosphorylase	-
D3880_RS18830 (D3880_18835)	-	4143013..4143921 (-)	909	WP_119894950.1	ABC transporter ATP-binding protein	-
D3880_RS18835 (D3880_18840)	-	4143918..4144739 (-)	822	WP_238474376.1	hypothetical protein	-
D3880_RS18840 (D3880_18845)	-	4144760..4145569 (-)	810	WP_238474377.1	hypothetical protein	-
D3880_RS23220 (D3880_18850)	pilA	4146271..4146456 (-)	186	WP_119894952.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
D3880_RS18850 (D3880_18855)	pilB	4146683..4148386 (+)	1704	WP_119894953.1	type IV-A pilus assembly ATPase PilB	Machinery gene
D3880_RS18855 (D3880_18860)	pilC	4148516..4149733 (+)	1218	WP_119894954.1	type II secretion system F family protein	Machinery gene
D3880_RS18860 (D3880_18865)	pilD	4149736..4150608 (+)	873	WP_119894955.1	prepilin peptidase	Machinery gene
D3880_RS18865 (D3880_18870)	coaE	4150612..4151229 (+)	618	WP_119894956.1	dephospho-CoA kinase	-
D3880_RS18870 (D3880_18875)	yacG	4151226..4151426 (+)	201	WP_119894957.1	DNA gyrase inhibitor YacG	-

Sequence

Protein

• Length: 61 a.a.
• Molecular weight: 6545.83 Da
• Isoelectric Point: 10.5719

>NTDB_id=315721 D3880_RS23220 WP_119894952.1 4146271..4146456(-) (pilA) [Pseudomonas cavernae strain K2W31S-8]
MKSLKKQKGFTLIELMIVIAIIGILAAIAIPQFNEYRAKANDTSAVADAKNGITAIISSLR

Nucleotide

• Length: 186 bp

>NTDB_id=315721 D3880_RS23220 WP_119894952.1 4146271..4146456(-) (pilA) [Pseudomonas cavernae strain K2W31S-8]
ATGAAGTCCCTCAAGAAGCAAAAAGGCTTTACCCTGATCGAGCTGATGATCGTGATCGCGATCATCGGCATTCTGGCCGC
TATCGCCATTCCGCAGTTCAATGAATATCGCGCCAAGGCTAACGATACGTCCGCGGTAGCTGATGCTAAGAATGGTATTA
CCGCAATTATTTCATCGCTGCGCTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-30)

3D structure

• AlphaFold DB: A0A385Z4R4

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA	Haemophilus influenzae Rd KW20	42.308	100	0.541
pilA	Haemophilus influenzae 86-028NP	42.308	100	0.541
pilA	Acinetobacter nosocomialis M2	55.172	95.082	0.525
pilA	Pseudomonas aeruginosa PAK	70.455	72.131	0.508
pilA/pilA1	Eikenella corrodens VA1	75.61	67.213	0.508
pilA	Vibrio parahaemolyticus RIMD 2210633	60	81.967	0.492
pilA	Ralstonia pseudosolanacearum GMI1000	60.417	78.689	0.475
pilV	Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539	59.184	80.328	0.475
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	65.909	72.131	0.475
pilA	Acinetobacter baumannii strain A118	64.444	73.77	0.475
pilA2	Legionella pneumophila str. Paris	63.043	75.41	0.475
pilA2	Legionella pneumophila strain ERS1305867	63.043	75.41	0.475
pilA/pilAI	Pseudomonas stutzeri DSM 10701	64.286	68.852	0.443
comP	Acinetobacter baylyi ADP1	72.973	60.656	0.443
pilA	Vibrio campbellii strain DS40M4	75	59.016	0.443
pilA/pilAII	Pseudomonas stutzeri DSM 10701	55.102	80.328	0.443
pilE	Neisseria gonorrhoeae MS11	65	65.574	0.426
pilE	Neisseria gonorrhoeae strain FA1090	65	65.574	0.426
pilA	Vibrio cholerae C6706	72.222	59.016	0.426
pilA	Vibrio cholerae strain A1552	72.222	59.016	0.426
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	72.222	59.016	0.426
pilA/pilA4	Thermus thermophilus HB27	62.5	65.574	0.41
pilA	Glaesserella parasuis strain SC1401	72.727	54.098	0.393
comF	Acinetobacter baylyi ADP1	60.526	62.295	0.377