Detailed information NTG1021140

Bioinformatically predicted

Overview

• Name: pilA
• Type: Machinery gene
• Locus tag: ABZP31_RS13500
• Genome accession: NZ_CP160437
• Coordinates: 2865411..2865575 (-)
• Length: 54 a.a.
• NCBI ID: WP_111282483.1
• Uniprot ID: -
• Organism: Acinetobacter sp. FL
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2860411..2870575

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ABZP31_RS13475 (ABZP31_13475)	rpoZ	2860845..2861126 (+)	282	WP_005024277.1	DNA-directed RNA polymerase subunit omega	-
ABZP31_RS13480 (ABZP31_13480)	-	2861331..2863430 (+)	2100	WP_138000901.1	HD domain-containing protein	-
ABZP31_RS13485 (ABZP31_13485)	-	2863519..2863902 (+)	384	WP_005024272.1	RidA family protein	-
ABZP31_RS13490 (ABZP31_13490)	-	2864125..2864319 (+)	195	WP_138000902.1	bacterioferritin-associated ferredoxin	-
ABZP31_RS13495 (ABZP31_13495)	bfr	2864628..2865092 (+)	465	WP_005405243.1	bacterioferritin	-
ABZP31_RS13500 (ABZP31_13500)	pilA	2865411..2865575 (-)	165	WP_111282483.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
ABZP31_RS13505 (ABZP31_13505)	-	2865862..2866974 (+)	1113	WP_111282485.1	UDP-N-acetylglucosamine 2-epimerase	-
ABZP31_RS13510 (ABZP31_13510)	-	2866995..2868098 (+)	1104	WP_111282487.1	glycosyltransferase family 4 protein	-
ABZP31_RS13515 (ABZP31_13515)	-	2868146..2869186 (+)	1041	WP_248133744.1	glycosyltransferase	-
ABZP31_RS13520 (ABZP31_13520)	-	2869186..2870217 (+)	1032	WP_111282491.1	class I SAM-dependent methyltransferase	-

Sequence

Protein

• Length: 54 a.a.
• Molecular weight: 5880.01 Da
• Isoelectric Point: 5.5272

>NTDB_id=1021140 ABZP31_RS13500 WP_111282483.1 2865411..2865575(-) (pilA) [Acinetobacter sp. FL]
MQKGFTLIELMIVLTIIGLLAVTAIPVSQNYVTHSQVSEALSMVNAYKSDLITL

Nucleotide

• Length: 165 bp

>NTDB_id=1021140 ABZP31_RS13500 WP_111282483.1 2865411..2865575(-) (pilA) [Acinetobacter sp. FL]
ATGCAAAAGGGCTTCACTTTGATTGAGCTGATGATTGTTTTGACAATCATTGGTCTTCTAGCTGTAACTGCTATTCCAGT
TTCTCAAAACTATGTGACTCACTCTCAAGTTTCGGAGGCTTTAAGTATGGTCAACGCATATAAGAGTGATTTAATCACGC
TTTAG

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-24)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilE	Neisseria elongata subsp. glycolytica ATCC 29315	60.784	94.444	0.574
pilA	Pseudomonas aeruginosa PAK	62.5	88.889	0.556
pilA	Acinetobacter nosocomialis M2	57.692	96.296	0.556
pilA	Vibrio parahaemolyticus RIMD 2210633	64.444	83.333	0.537
pilA	Haemophilus influenzae 86-028NP	54.902	94.444	0.519
pilA	Haemophilus influenzae Rd KW20	54.902	94.444	0.519
pilA	Acinetobacter baumannii strain A118	58.333	88.889	0.519
pilA	Vibrio cholerae C6706	54	92.593	0.5
pilA	Vibrio cholerae strain A1552	54	92.593	0.5
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	54	92.593	0.5
pilE	Neisseria gonorrhoeae MS11	55.102	90.741	0.5
pilE	Neisseria gonorrhoeae strain FA1090	55.102	90.741	0.5
pilA/pilAI	Pseudomonas stutzeri DSM 10701	54.167	88.889	0.481
comP	Acinetobacter baylyi ADP1	54.167	88.889	0.481
pilA2	Legionella pneumophila str. Paris	55.319	87.037	0.481
pilA2	Legionella pneumophila strain ERS1305867	55.319	87.037	0.481
pilA	Ralstonia pseudosolanacearum GMI1000	53.061	90.741	0.481
pilA	Glaesserella parasuis strain SC1401	50.98	94.444	0.481
pilA/pilA1	Eikenella corrodens VA1	49.02	94.444	0.463
comF	Acinetobacter baylyi ADP1	54.545	81.481	0.444
pilA/pilAII	Pseudomonas stutzeri DSM 10701	48.936	87.037	0.426
pilA	Vibrio campbellii strain DS40M4	57.895	70.37	0.407
pilA/pilA1	Synechocystis sp. PCC 6803	46.667	83.333	0.389
pilX	Neisseria meningitidis 8013	52.632	70.37	0.37
pilL	Neisseria gonorrhoeae MS11	52.632	70.37	0.37