Detailed information    

experimental Experimentally validated

Overview

Name   yaaT   Type   Regulator
Locus tag   BSU_00320 Genome accession   NC_000964
Coordinates   41657..42484 (+) Length   275 a.a.
NCBI ID   NP_387913.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   accelerate the production of Spo0A~P   
Competence regulation

Function

YmcA and YlbF interact with a third protein, YaaT to form a tripartite complex. The YmcA-YlbF-YaaT complex affects the phosphotransfer between Spo0F and Spo0B, thus accelerating the production of Spo0A~P.


Genomic Context

Location: 36657..47484
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_00270 (BSU00270) yaaO 37720..39162 (+) 1443 NP_387908.1 putative decarboxylase -
  BSU_00280 (BSU00280) tmk 39159..39797 (+) 639 NP_387909.2 thymidylate kinase -
  BSU_00290 (BSU00290) darA 39871..40200 (+) 330 NP_387910.1 signal transduction receptor, cyclic di-AMP binding -
  BSU_00300 (BSU00300) yaaR 40213..40653 (+) 441 NP_387911.1 hypothetical protein -
  BSU_00310 (BSU00310) holB 40665..41654 (+) 990 NP_387912.1 DNA polymerase III clamp loader delta' subunit -
  BSU_00320 (BSU00320) yaaT 41657..42484 (+) 828 NP_387913.1 subunit of a sporulation, competence and biofilm formation regulatory complex of RNaseY (RicAFT complex / FAD / two [4Fe-4S]2+) Regulator
  BSU_00330 (BSU00330) dnaH 42499..42858 (+) 360 NP_387914.1 subunit of the DNA replication complex -
  BSU_00340 (BSU00340) trmNF 42917..43660 (+) 744 NP_387915.1 tRNA1(Val) (adenine(37)-N6)-methyltransferase -
  BSU_00350 (BSU00350) yazA 43647..43946 (+) 300 NP_387916.1 putative UvrC-Intron-type (URI) endonuclease -
  BSU_00360 (BSU00360) rsmI 43921..44799 (+) 879 NP_387917.1 16S rRNA 2'-O-ribose C1402 methyltransferase -
  BSU_00370 (BSU00370) abrB 44848..45138 (-) 291 NP_387918.1 transcriptional regulator for transition state genes (AbrB-SurF) Regulator

Regulatory network

Positive effect      
Negative effect
Regulator Target Regulation
  yaaT spo0A positive effect
  spo0A comK negative effect
  comK comK positive effect
  comK late competence genes positive effect
  codY comK negative effect
  clpP comK negative effect
  mecA comK negative effect
  kre comK negative effect
  abrB comK negative effect
  comS comK positive effect
  spo0A comK positive effect
  rok comK negative effect
  degU comK positive effect
  clpC comK negative effect
  med comK positive effect
  comK late competence genes positive effect
  clpP degU negative effect
  abrB rok negative effect
  spo0A abrB negative effect
  comA comS positive effect
  spo0A rok negative effect
  ylbF spo0A positive effect
  ymcA spo0A positive effect
  sinR spo0A negative effect
  sinR rok negative effect
  sinR degU negative effect
  degQ degU positive effect
  clpC degU negative effect
  degS degU positive effect
  rapC comA negative effect
  rapF comA negative effect
  comP comA positive effect
  sinI sinR negative effect
  phrC rapC negative effect
  phrF rapF negative effect
  comX comP positive effect
  comQ comX positive effect

Sequence

Protein


Download         Length: 275 a.a.        Molecular weight: 31219.06 Da        Isoelectric Point: 4.7658

>NTDB_id=667 BSU_00320 NP_387913.1 41657..42484(+) (yaaT) [Bacillus subtilis subsp. subtilis str. 168]
MYNVIGVRFKKAGKIYYFDPNGFHIEHDSCVIVETVRGVEYGQVVIANKQVDEHDVVLPLRKVIRVADDRDLLIVEENKQ
EALSAFDICQKKVIEHGLDMKLVDVEFTFDRNKVIFYFTADGRVDFRELVKDLASIFKTRIELRQIGVRDEAKMLGGIGP
CGRMLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENDEYETAKEQLPDIGEMITTANGPAKVVGLNI
LERVLQVELINREKVIEYTWEELLEEGVVSAQTTD

Nucleotide


Download         Length: 828 bp        

>NTDB_id=667 BSU_00320 NP_387913.1 41657..42484(+) (yaaT) [Bacillus subtilis subsp. subtilis str. 168]
TTGTACAATGTAATTGGTGTCCGCTTTAAGAAAGCGGGTAAAATATATTATTTTGATCCGAATGGATTTCATATAGAACA
TGACAGCTGCGTAATTGTAGAAACTGTCAGAGGCGTTGAGTACGGCCAGGTCGTAATTGCAAATAAACAGGTGGATGAGC
ATGATGTGGTGCTTCCCCTTCGAAAAGTGATACGTGTGGCAGACGATCGCGATCTTCTCATTGTAGAAGAAAATAAACAG
GAAGCACTATCAGCATTTGATATCTGCCAAAAGAAAGTGATTGAGCATGGCTTGGATATGAAGCTGGTCGATGTTGAATT
CACGTTTGATCGCAATAAAGTCATTTTTTACTTCACTGCTGACGGCCGAGTCGACTTTAGAGAGCTTGTAAAGGATTTGG
CTTCTATCTTTAAGACAAGAATTGAGCTGCGCCAAATCGGAGTGAGGGATGAGGCAAAAATGCTCGGAGGAATCGGTCCT
TGCGGAAGAATGCTTTGCTGTTCAACGTTTCTTGGAGATTTTGAACCCGTTTCCATTAAAATGGCCAAGGATCAGAACTT
GTCTTTAAATCCTACGAAGATTTCGGGTCTTTGCGGACGATTGATGTGCTGTCTAAAATATGAGAACGATGAGTATGAGA
CGGCAAAAGAACAGCTTCCGGATATAGGAGAAATGATTACGACAGCAAACGGTCCCGCGAAGGTCGTCGGACTAAATATT
CTGGAACGGGTGCTTCAGGTGGAACTGATAAACCGTGAAAAAGTGATAGAATATACTTGGGAAGAGCTCTTGGAAGAGGG
CGTCGTATCCGCACAAACCACAGATTAA

Domains

Predicted by InterProScan.

PSP1 C-terminal conserved region (PSP1)

(62-146)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References

[1] Eugenie Dubnau et al. (2023) Formation of a stable RNase Y-RicT (YaaT) complex requires RicA (YmcA) and RicF (YlbF). MBio 14(4):e0126923. [PMID: 37555678]
[2] Valerie J Carabetta et al. (2013) A complex of YlbF, YmcA and YaaT regulates sporulation, competence and biofilm formation by accelerating the phosphorylation of Spo0A. Molecular Microbiology 88(2):283-300. [PMID: 23490197]
[3] Shigeo Hosoya et al. (2002) Mutation in yaaT leads to significant inhibition of phosphorelay during sporulation in Bacillus subtilis. Journal of Bacteriology 184(20):5545-53. [PMID: 12270811]